SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017818934.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017818934.1.60252
Domain Number 1 Region: 55-835
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.67e-293
Family Motor proteins 1.75e-16
Further Details:      
 
Domain Number 2 Region: 836-961
Classification Level Classification E-value
Superfamily Myosin rod fragments 5.23e-22
Family Myosin rod fragments 0.00031
Further Details:      
 
Domain Number 3 Region: 956-1072
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.22e-20
Family Myosin rod fragments 0.001
Further Details:      
 
Domain Number 4 Region: 1242-1349
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.62e-17
Family Myosin rod fragments 0.003
Further Details:      
 
Domain Number 5 Region: 1060-1150
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000068
Family Myosin rod fragments 0.0037
Further Details:      
 
Domain Number 6 Region: 1514-1627
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000222
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 7 Region: 1349-1450
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000288
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number 8 Region: 1760-1860
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000506
Family Regulator of G-protein signaling, RGS 0.0087
Further Details:      
 
Weak hits

Sequence:  XP_017818934.1.60252
Domain Number - Region: 1825-1923
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00209
Family Myosin rod fragments 0.017
Further Details:      
 
Domain Number - Region: 27-60
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.0392
Family Myosin S1 fragment, N-terminal domain 0.0016
Further Details:      
 
Domain Number - Region: 1158-1230
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0942
Family Myosin rod fragments 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017818934.1.60252
Sequence length 1960
Comment PREDICTED: myosin-9 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAYVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
INFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNT
DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
TYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF
NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK
SFVEKVVQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL
HQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMAT
LRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQR
YEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKIT
DVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQV
SRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAE
ELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESARQ
KLQLEKVTTEAKLKKLEEEQIIMEDQNCKLAKEKKLLEDRIAEFTTNLMEEEEKSKSLAK
LKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAK
KEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEE
LEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEE
LAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVK
FNEGERVRTELADKVTKLQVELDNVTGLLTQSDSKSSKLTKDFSALESQLQDTQELLQEE
NRQKLGLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVGCL
ETAEEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQTACNLE
KKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNK
QFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEV
NLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLK
DLEAHIDSANKNRDEAIKQLRKLQAQMKDCMRELDDTRTSREEILAQAKENEKKLKSMEA
EMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIVQLEEELEE
EQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGT
VKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDMLLQVDDERRNAEQ
YKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNK
LRRGDLPFVVPRRMARKGAGDCSDEEVDGKADGAEAKPAE
Download sequence
Identical sequences F6ZZ90
XP_017818934.1.60252 ENSCJAP00000025369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]