SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017826145.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017826145.1.60252
Domain Number 1 Region: 360-576
Classification Level Classification E-value
Superfamily L domain-like 2.49e-35
Family Ngr ectodomain-like 0.012
Further Details:      
 
Domain Number 2 Region: 39-261
Classification Level Classification E-value
Superfamily L domain-like 1.56e-34
Family Ngr ectodomain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017826145.1.60252
Sequence length 696
Comment PREDICTED: SLIT and NTRK-like protein 1 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MLLWILLLETSLCFAAGNVTGDVCKEKICSCNEIEGDLHVDCEKKGFTSLQRFTAPTSQF
YHLFLHGNSLTRLFPNEFANFYNAVSLHMENNGLHEIVPGAFLGLQLVKRLHINNNKIKS
FRKQTFLGLDDLEYLQADFNLLRDIDPGAFQDLNKLEVLILNDNLISTLPANVFQYVPIT
HLDLRGNRLKTLPYEEVLEQIPGIAEILLEDNPWDCTCDLLSLKEWLENIPKNALIGRVV
CEAPTRLQGKDLNETTEQDLCPLKNRVDSSLPAPPAQEETFAPGPLPTPFKTNGQEDHAT
PGSAPNGGTKIPGNWQIKIRPTAAIATGSARNKPLANSLPCPGGCSCDHIPGSGLKMNCN
NRNVSSLADLKPKLSNVQELFLRDNKIHSIRKSHFVDYKNLILLDLGNNNIATVENNTFK
NLLDLRWLYMDSNYLDTLSREKFAGLQNLEYLNVEYNAIQLILPGTFNAMPKLRILILNN
NLLRSLPVDVFAGVSLSKLSLHNNYFMYLPVAGVLDQLTSIIQIDLHGNPWECSCTIVPF
KQWAERLGSEVLMSDLKCETPVNFFRKDFMLLSNDEICPQLYARISPTLTSHSKNSTGLA
ETGTHSNSYLDTSRVSISVLVPGLLLVFVTSAFTVVGMLVFILRNRKRSKRRDANSSASE
INSLQTVCDSSYWHNGPYNADGAHRVYDCGSHSLSD
Download sequence
Identical sequences A0A2J8PBA2 A0A2K6S3A1 F7I9M4 G3S5N8 H2NK41
ENSGGOP00000023394 9598.ENSPTRP00000010123 9600.ENSPPYP00000006192 ENSPTRP00000010123 ENSCJAP00000040437 ENSPPYP00000006192 ENSPPYP00000006192 XP_003832062.1.60992 XP_009246993.1.23681 XP_009425394.1.37143 XP_010339943.1.74449 XP_017826145.1.60252 XP_018895029.1.27298 ENSGGOP00000023394 ENSCJAP00000040437 ENSPTRP00000010123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]