SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017826551.1.60252 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017826551.1.60252
Domain Number 1 Region: 13-40,89-164
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.85e-25
Family Voltage-gated potassium channels 0.0038
Further Details:      
 
Domain Number 2 Region: 151-251
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.15e-17
Family Voltage-gated potassium channels 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017826551.1.60252
Sequence length 309
Comment PREDICTED: potassium channel subfamily K member 16 isoform X3 [Callithrix jacchus]; AA=GCF_000004665.1; RF=representative genome; TAX=9483; STAX=9483; NAME=Callithrix jacchus; AL=Chromosome; RT=Major
Sequence
MPGAWLCSCWGGRVLPLLLAYVCYLLLGATIFQLLEKQAEAQSRNEFQLEKLRFLENYTC
LDQWALEQFVQVIMEAWVKGVNPKGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEA
GQVFCVFYALLGIPLNVIFLNNLGTGLRAHLATIERWEDQPRRSQLLRVLGLALFLTLGT
LVILIFPPMVFSHVEGWSFGEGFYFAFITLSTIGFGDYVVGTDPSKHYISVYRSLAAIWI
LLGLAWLALILPLGPLLLHRCCQLWLLRLRQGCGAKEAPGRRPRGGSIAARGVQVTPQNF
ATSKRELGS
Download sequence
Identical sequences F7HMK7
XP_017826551.1.60252 ENSCJAP00000010880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]