SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017843903.1.30616 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017843903.1.30616
Domain Number 1 Region: 768-988
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-52
Family DBL homology domain (DH-domain) 0.00025
Further Details:      
 
Domain Number 2 Region: 68-186
Classification Level Classification E-value
Superfamily BRCT domain 3.49e-20
Family DNA topoisomerase II binding protein 1, TopBP1 0.072
Further Details:      
 
Domain Number 3 Region: 204-252
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000262
Family DNA-repair protein XRCC1 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017843903.1.30616
Sequence length 1246
Comment PREDICTED: protein ECT2 isoform X1 [Drosophila busckii]; AA=GCF_001277935.1; RF=representative genome; TAX=30019; STAX=30019; NAME=Drosophila busckii; AL=Chromosome; RT=Major
Sequence
METIEEQTKTEMSIMPKQPTRICLVGVAAQDADTLRAAESYGMPVIISETGLELLGDAMW
RTYYVLQDFESDNFEAIHKQKECILGPPALKYAAEMKQTLGQNTRPIYNYAMRGVVTCFT
GIRKKDELTKLVNLIHSMGGCIKKDLNTKTTHLICNHSGGEKYQYAKTFRLTVVRPAWVY
AAWLARDSLEFEATQDNFTKAHRLKAFEGQKICFFGFPPEEQQHMVDVLLENGGVCAELD
DPECSHVVMPNTGAVLTSSSTNSTDTNPSTNNASQQQQQQQQPTDVADAAQQQQQLQQSD
KENEEDADDIHFDERLFVAASDMQQLEELPLSDSADDEDADLVSEDVQASTPKRQSPQDP
EQEQACSPTAELSPILKSSVKHTLAIETINECDMETDDLMSNAAENELKRKRDSFDSVSL
MSVDSFALPASTKKPKLIRTGSITRTLKRSMSFVADRTPIIKTLRTRRSSIAVADTSTFL
ASDTIEAEAADDSICSLASFSSTLNESIRKPVKEKLRSICGRITRSSSRRAERETTTPDC
SQLDSGFKTPKAPLQRFGGSASASKLTAKRLFGSNTVSAAASSAAALTFATNQAATAQVP
TTAITSSKTNNNIITASSSMQSSTTVATSSPVRSEEPMPMVVDEHTTVSKPETRNHHTHI
LKSDWFWYTIQNGYANEMDYLFGDYLDSITNTPNTDRRDSLPISFNKRKRKRFSQRIQLE
GTPLGSGKRRSSVSDAGLLSVSNSFFDCTTSPDKLDNDKLLHAEPEASEISATPIKKSMR
FNHFMDFYTTESNYVGILDTILNLFKNKLDELAETNDPLLNKSEIKSIFGNFLPIHEVHQ
SMLEHLRQLHANWREDCLIGDIIIHHRDELIKAYPPYVNFYEHMKEQLQYCDREYPRFHA
FLKINQTKPECGRQSLQDLMIRPVQRLPSISLLLNDILKHTGGSNADHARLEDALKAIKQ
VTLHINDDKRRTESRMAIFDIFNDIDGCPAHLVSSNRSFISKCEVNELSDSLSGRGDSLV
LYLFSDSIELCKRRSRGFNSAKSPSTAKTHKHIKLISLNTIRFVIDITDSTRAFGLLQRG
EKEKLYTFSIIDEETDKLVYLKKLCMQIAAHTCRTDADKMLLSRTSLELEVDISDVNVST
LSKAFKLAAKTRLKVGRAFSFNKTPNKLKRAVSTMMTSPFGSTNSLTPASHLAHMRLASC
TNINEVDDEDCSSMRSSSPSTQSEMLVVPPLSVQPTRKNKAVVGRI
Download sequence
Identical sequences XP_017843903.1.30616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]