SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017853642.1.30616 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017853642.1.30616
Domain Number 1 Region: 94-543
Classification Level Classification E-value
Superfamily Sema domain 7.19e-130
Family Sema domain 0.000055
Further Details:      
 
Domain Number 2 Region: 1414-1543,1752-1913
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.56e-43
Family p120GAP domain-like 0.047
Further Details:      
 
Domain Number 3 Region: 905-999
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000611
Family Other IPT/TIG domains 0.0079
Further Details:      
 
Domain Number 4 Region: 546-597
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000353
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 5 Region: 998-1086
Classification Level Classification E-value
Superfamily E set domains 0.00000000000484
Family Other IPT/TIG domains 0.066
Further Details:      
 
Domain Number 6 Region: 1105-1187
Classification Level Classification E-value
Superfamily E set domains 0.00000462
Family E-set domains of sugar-utilizing enzymes 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017853642.1.30616
Sequence length 1970
Comment PREDICTED: plexin-A2 [Drosophila busckii]; AA=GCF_001277935.1; RF=representative genome; TAX=30019; STAX=30019; NAME=Drosophila busckii; AL=Chromosome; RT=Major
Sequence
MHILHVCQLLLLLLITILVNQSKRVIAHGELVHLTNIRNEKLDVGEDTNPNPAEVLALAS
RANRNTNISTPDLVLSDGESNSGSSSIITNIAKFDTKLNHLLVDTITGRVFVGGVNRLYQ
LSPDLELHETVKTGPQNDSVECTILDCPINAIRKPTDNYNKVLLIDRATSRLIACGSLFQ
GTCTVRNLQNVSIVEHEVPDAVVANDANSSTVAFIAPGPPQHPVTNVMYVGVTYTNNSPY
RSEIPAVASRSLENSKMFQIASSAVTTGTRTFINSYARESYLVSYVYGFSSERFSYFLTT
QLKHSHHSSPKEYITKLVRICQEDSNYYSYTEIPVECISDAQGGTKFNLVQAGFLGKPSS
DLAQSLGISIQDDVLFAAFSKGDSNVPTNNSALCIYSLKAVRRKFMQNIKFCFNGNGMRG
LDFISPSMPCVLTKLQTIGEDFCGLDVNSPLGGEQPITSVPVAMFSTRITSVAATSTSGY
TVVFLGTEQGYIKKVVVESSNVANEYASLAVDVGSVINQDMQFDNQNLYIYAMSERKVSK
VKVFDCGDYKTCGECLGARDPYCGWCSLENKCSPRSNCQDDANDPLYWVSYKTGKCTTIT
SVVPHQLQRTTARTLELIIDHLPQLKENLICAFTTEDKALFTNATKKRNGVNCTTPRTDM
LPQIEQGKHHFTAKLSVRTRNGPDLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRC
THDTAENCRNDILVTGISRIGPSYRSGPGFCPTINATGDGSEVLVAAGTSKSIKVKVHII
GQFIVQTRFVCQFNIEGRVTSLNAQLLGDTIYCDSMEFQYTSRSPNLTATFAVIWGGSKP
LDNPHNIHVVIYRCRDMADSCGICLALAEKYNCGWCSSTNTCEVVEQCNKNNEGKTDWLN
RSEICPNPEIHSFEPKTGPWEGGTNITIRGINLGKNYNDIYSGVRIAGINCMPFPQFYID
TKQIVCTVDSPGEQMYRNGRIVVQIGDYRGESKEDYEFVDPKISNFYPRFGPTSGGTQIR
IIGKHLNAGSRIQAFINDHLPCKILSADASQAVCLTSPSPGIIEGRMKMSFDNGPREFND
YNFKYVLDPTVQQVSSGPSAQIKVPKGIPAGGIRISAMGTQFSSIQAPSIYVFYKSQMYV
SQCHVNSDTEMECPSPIVEAESNTLDPDNPLLLEYGFLMDNVLRVQNLSRSHNNHFELYP
NPEYFAFEERVKYFKSEYLTINGRNLDRACKESDVQVKIGNGYCNITSLSRQQLTCRPPS
ESAATSSNSNSGPEVVVRIGTSLEYRIGILSYESSNLITDWGDNVVFVVFAGICVFVFIF
VALLVAYRKKTSESNRVLRNMQEQMDILELRVAAECKEAFAELQTEMTDLTGDLTSGGIP
FLDYRSYAMKILFPNHEDHIVLQWERPELLRKEKGLRLFAQLIMNKTFLLLFIRTLESNR
YFSMRERVNVASLIMVTLQSKLEYCTDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEK
MLSAWFTFLLYKFLKECAGEPLYMLFRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSID
FRPMTVNASIIQQPIFCNNLDMLPSHTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSQR
PRKDELDLEWRTGATGRVILYDEDATSKTESEWKKLNTLQHYNVPDGASLSLVPKQSSIY
NFSILSDKNEKSHKYETLNISKYPSSSPTFSRAGSPLNNDMHDNGLKYWHLVKHHDSDIQ
KEGERVNKLVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQ
ALLHGITDPEVVHTWKSNSLPLRFWVNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCS
TSDHRLGKDSPSSKLLYAKDIPEYRKWVDRYYRDIRDMSSISDQDMNAMLAEESRLHTTE
FNTNCALHELYTYAVKYNEQLMVTLEEDEFSQKQRLAYKLEQVHNIMSAE
Download sequence
Identical sequences A0A0M4EL53
XP_017853642.1.30616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]