SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017861649.1.65068 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017861649.1.65068
Domain Number 1 Region: 486-648
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 9.29e-65
Family A middle domain of Talin 1 0.0000408
Further Details:      
 
Domain Number 2 Region: 2279-2471
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.62e-51
Family I/LWEQ domain 0.00014
Further Details:      
 
Domain Number 3 Region: 657-779
Classification Level Classification E-value
Superfamily I/LWEQ domain 4.19e-49
Family I/LWEQ domain 0.0000843
Further Details:      
 
Domain Number 4 Region: 749-885
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.37e-42
Family I/LWEQ domain 0.0002
Further Details:      
 
Domain Number 5 Region: 1831-1962
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.57e-32
Family VBS domain 0.00034
Further Details:      
 
Domain Number 6 Region: 1215-1351
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.62e-31
Family VBS domain 0.012
Further Details:      
 
Domain Number 7 Region: 203-317
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-30
Family Second domain of FERM 0.00000936
Further Details:      
 
Domain Number 8 Region: 318-408
Classification Level Classification E-value
Superfamily PH domain-like 1.76e-25
Family Third domain of FERM 0.0000536
Further Details:      
 
Domain Number 9 Region: 1072-1197
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000000439
Family alpha-catenin/vinculin 0.026
Further Details:      
 
Domain Number 10 Region: 1997-2121
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000188
Family VBS domain 0.015
Further Details:      
 
Domain Number 11 Region: 941-1041
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000628
Family I/LWEQ domain 0.004
Further Details:      
 
Domain Number 12 Region: 1457-1540
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000314
Family I/LWEQ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017861649.1.65068
Sequence length 2835
Comment PREDICTED: talin-2 isoform X4 [Drosophila arizonae]; AA=GCF_001654025.1; RF=representative genome; TAX=7263; STAX=7263; NAME=Drosophila arizonae; AL=Scaffold; RT=Major
Sequence
MSTLSLRIQLEGGRVTKTIQFQPNTTVFDACKIIRDKFAEAVQGQPSEYGLFISDEQNQQ
GVWLEAGRTLGYYILHNQDTLEYRRKLRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTK
IGITNHEEYGLVREDNEAQNENLPDNKFATLTLKRKFTEKDRDAKMESLRKKLKTDDEMN
WVDVGRTLREQGIDESETVLLRRRFFFSDQNIDSRDPVQLNLLYVQARDAILDGTHPVTQ
DKACEFAGIQVHIQFGPYNEAKHKPGFLDLKDFLPQSYVRVKNIEKKIFAEHKKHYELTE
IDAKVLYTKTARELPTYGVTFFLVKEKMNGKNKLVPRLLGVTKDSVLRLDERTKEILVSW
PLTTVRRWGASPNTFTLDFGDYANQYYSVQTTEAEQIVQLIAGYIDIILKKKQTKDHFGI
EGDEGSTMVEESVAPSKATFLQHETNRVEKLNLESLAHPGIMRPYDENGHAKFHKTKEVR
ISSVNLTEPQRALIGYISAGQDVLIRADEELRTKAPIQELGSDLRSIEWRENTLDTSKQA
VSSHVATMSAATAQIITASQPDEVDTEAISASVSQIAQTIPEVTKEVRLIAALMENDTNG
DQLLEAARNLCNAFSDLLKAAEPESKEPPQHLINAATRVGEATTHVLSTIAEEEAPENRD
LHDMLVDLGKAVANTTAALVLRAKNIAASCEDDQARNRVIAAASQCALATSQLVACAKVV
APTLHNAACREQLEAAARNVARAVNALCEVCNEASTDPKLKADLMDAARDVSKSLLDMLE
HVKLSTREHAHRTSQELSPVENVIIGTDVLVSTNDPQEMVRHARTLGQTTAQLIQSIKGE
ADQQEDADMQRRLLSAAKQLADATAKLVEAARLCSSNPHDSDNQNALRRAAEELREITTS
TANTPAMKRGLIQRLEYHSKLAASAATQCISAAQNAVQHSQDHQTKESLLQDCKRVADTI
PRLVTSVKTTRAQPDDAHAQLNLIEAAEQFIEPALQVSKSSRALRPTVTDIPSATQLSKS
ALHLGQAVSELHSVAQRARDACGGQELESALEAVRKLHHVLDDTRQTALAGQLRPLPGET
VENTADELRKSAKNVGIALSQLLSSVLQGQRQYAGAAGRDTALALGEFTKSVHGVAATTQ
NPAIIDCADDVVTSSAQLIEQAQRTLKGVSDPQALTQAGRDVTGALSRTVDCIPGQREVD
AALRNVSDLSEILSVSEFPPSNRPYAELQSELKQVAEQLSTAGGQIVQSYASPALLADSS
QQFAANYRDLLSVSMQMAGQAQTDEPVRSQMIDSLRNVSTQSCSLLSTAKSIAADPGQPN
AKNLLLAAARSVTESINQLVDASIQSAPGQKECDNAIRNIDALRRMLDYPHEPINEMGYF
DCVEQATAKSRNLGYAISEMINNAKQSQHVEFSQSVNNVNESIQGLMESSSQAAYLIGVS
HPSSVAGRPGIIDEAQLTWAYQGIRQHCDIVSSAQSGKPQMISALTVIAKHTSYLCSICR
QASMNTNNPVAKNEFIVLAKQVATATSDLVQDIKAIEDNPTGGNRDRLVEPLLEAVKAVR
QYASSPEFTSVPAKISAEGRKAQEPVIQAGRGVIDGVVEMVKAAKSLALTPDNPPVWQQL
SMHSTPVSESVKRLVDNIRDKAPGQAQCEQVLHTLGTCTRELDSCALAANAQGLSRRRDN
NLHGFSGQTMNAAAELLDKLEPIRVAGKNNAEQLGHAVGEISRYVVPMVNGAIGACTHIV
HSQQQMSLINQTKSVVESAITLVQSAKDSAGNPRATHAHPRLDEAIDGTREAIQELQQAV
EKINAETGIVTGLMEQVNRAITRLTDKRQSLLNASYSDSFVDYQTRMVATAKEIARLGNE
MNAKSSVEPAVLPQLAVEMTQHYQLLTQDSVGASTTTTSPDVAMRIRSTVIDLGRSISSM
IQSSAGGASPNDSSAQKEIARNARDVSEKVAQVLAALQAGSRGTQACINAAHTVSGIIGD
LDTTIMFATAGTLHSDGDGSFADHREHILQTAKALVEDTKVLVTGAAGTQDQLANAAQNA
VSTITQLAEAVKRGACSLGSSQPDSQVMVINAVKDVASALGDLINCTKLASGKPIHDPSM
QGLKESARVMVLNVSSLLKTVKAVEDEHTRGTRAMEATVEAISQEMRAMQTPPPVGSAQV
GPEDLIRVTMNVTAATAKAVAAGTSNLQADIVAAANLGRRAISDMLIVCRSVAWNCAETD
ELRVRTLEAGSSVAESYRELLNGILHNCSADDRMHLSRRVAKCVTDLVAMARLLKGSDWI
DPEDPTVIAENELLGAAASIDAAAKKLASLRPRRQADVKIELDENMKFDEMILEAAKGIM
GASAALVRAANAAQRELIDQGKVARRPLTSSDDGQWSEGLISAARLVAAATHSLVEAAQN
LVRGVGTEEMLISTAKQVAASTAQLLIACKVKSNPNSEAGRRLQAAGNAVIKSTDNLVHA
AQQGLEAEEEHSLKINTSMVDGMAQEINARSAVLRKEKELEEARQRLKHVRQAQRYAKNT
QGFTTDESDTEYAYGTLNRSQNNTLGRGGGAYYGSQSGDLPSSPSYYTGSGAGSQQKHHY
NYASPQPQHFHHPGAVSPPPSNYAVMDDVNGDFPPPPPPLSTTISNMQTATSTHSFRSNP
KLTANAVPRPYPGSPVGGAGSNGFTTISASTPTNANNYQQSFESSSIKTQNSSTSGAPPT
VPPPPPQKPTGNRNLEACVQDLHDKTFGQGGVVEITGGNAYPGQNYEGYTSRYETRNFDK
TANTSSNSESGLVKPLESSFSQMTLNTDGGKISIVDQGSERLTSMTQRVMERKSFTTTTE
SRSETKTEKHSFRLE
Download sequence
Identical sequences XP_017861649.1.65068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]