SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017869185.1.65068 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017869185.1.65068
Domain Number 1 Region: 72-523
Classification Level Classification E-value
Superfamily Sema domain 5.1e-132
Family Sema domain 0.0000462
Further Details:      
 
Domain Number 2 Region: 885-979
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000955
Family Other IPT/TIG domains 0.009
Further Details:      
 
Domain Number 3 Region: 1393-1522,1553-1574
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000000000000294
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 4 Region: 978-1066
Classification Level Classification E-value
Superfamily E set domains 0.00000000000116
Family Other IPT/TIG domains 0.062
Further Details:      
 
Domain Number 5 Region: 526-577
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000017
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 1085-1167
Classification Level Classification E-value
Superfamily E set domains 0.00000000611
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017869185.1.65068
Sequence length 1673
Comment PREDICTED: plexin-A2 [Drosophila arizonae]; AA=GCF_001654025.1; RF=representative genome; TAX=7263; STAX=7263; NAME=Drosophila arizonae; AL=Scaffold; RT=Major
Sequence
MNILICCVLSITIFEISSASASSSLGNGLTSWIQQEDRIKRRASALKINLTETDMNVGYL
NSSSSSVITHVARFDTTLNHLLVDTITGRVFVGGVNRLYQLSPDLELHETVKTGPQNDSV
ECTILDCPLNAIRKPTDNYNKVLLIDRATSRLIACGSLFQGTCTVRNLQNVSIIEHEVPD
AVVANDANSSTVAFIAPGPPQHPVTNVMYVGVTYTNNSPYRSEIPAVASRSLEKSKMFQI
ASSAVTTGTRTFINSYARENYLVNYVYGFSSERFSYFLTTQLKHSHHSSPKEYITKLVRI
CQEDSNYYSYTEIPVECISEAQGGIKFNLVQAGFLGKPSLDLAQSLGISIQDDVLFAVFS
KGESNTPTNSSALCIYSLKSIRRKFMQNIKFCFNGNGMRGLDFISPSMPCVLTKLQTIGE
DFCGLDVNSPLGGEQPITAVPVAMFNTLLTSVAATSTSGYTVVFIGTVDGYIKKVVVESS
TIANEYASLAVDVGSPIKQDMQFDNQNLYVYAMSDRKVSKVKVYDCADFRTCGECLGARD
PYCGWCSLENKCSPRSNCQDDANDPLYWVSYKTGKCTTITSVVPHQLQRTTARTLELIID
HLPQLKENLICAFTTEDKALFTNATKKRNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTR
NGPDLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRI
GPSYRSGPGFCPTINATGDGSEVLVAAGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVT
SLNAQLLGDTIYCDNMEFQYTSRSPNLTATFAVIWGGSKPLDNPHNIHVVIYRCRDMADS
CGICLALAEKYNCGWCSSTNTCEVVEQCNKNNEGKTDWLNRSEICPNPEIHSFEPKTGPW
EGGTNITIKGINLGKNYNDIYSGVRIAGINCMPFQQFYIDTKQIVCTVDSPGEQMYRNGR
IVVQIGDYRGESKEDYEFVDPKISNFYPRFGPTSGGTQIRIIGKHLNAGSRIQAYINDHL
PCKIISTDSSQAICRTSPSPGIIEGRLKMSFDNGPREFNDYNFKYVLDPTVEHVSSGPSA
QIKIPKGIPAGGIRIVVTGTQFTSIQSPSIYVLYNGQMYASQCRVHSDTEMKCPSPVIEA
DSQTLDPDNPTLLEYGFLMDNVLKVQNLSKKHNNHFELYPNPEYFAFEERVKYFKSEYLT
INGRNLDRACKETDVEVKIGNGFCNITSLSRQQLTCRPPTEASAASNSPSGPEVIVRIGS
SLEYRIGILSYESSNLIMDWGDNVVFVVIAGCVIFLLIFVALLVAYRKKTSESNRVLRNM
QEQMDILELRVAAECKEAFAELQTEMTDLTGDLTSGGIPFLDYRSYAMKILFPNHEDHNV
LQWEKPELLRKEKGLRLFAQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSK
LEYCTDILKTLLSDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKECAGEP
LYMLFRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRAMTVNASIIQQPIFCNNLD
MLPSHTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSQRPRKDDLDLEWRTGATGRVILY
DEDATSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSIYNFSILSDKNEKSHK
Download sequence
Identical sequences XP_017869185.1.65068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]