SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017869284.1.65068 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017869284.1.65068
Domain Number 1 Region: 113-565
Classification Level Classification E-value
Superfamily Sema domain 1.31e-117
Family Sema domain 0.0000327
Further Details:      
 
Domain Number 2 Region: 1524-1649,1859-2043
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.16e-44
Family p120GAP domain-like 0.03
Further Details:      
 
Domain Number 3 Region: 927-1016
Classification Level Classification E-value
Superfamily E set domains 0.000000000000322
Family Other IPT/TIG domains 0.017
Further Details:      
 
Domain Number 4 Region: 567-618
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000103
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 5 Region: 1136-1206
Classification Level Classification E-value
Superfamily E set domains 0.000000000028
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.063
Further Details:      
 
Domain Number 6 Region: 1017-1094
Classification Level Classification E-value
Superfamily E set domains 0.00000000994
Family Other IPT/TIG domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017869284.1.65068
Sequence length 2079
Comment PREDICTED: plexin-B [Drosophila arizonae]; AA=GCF_001654025.1; RF=representative genome; TAX=7263; STAX=7263; NAME=Drosophila arizonae; AL=Scaffold; RT=Major
Sequence
MLRQILRLLGAILMLNVFLINFKMRWAVHCIKVEHGHTQTHSYIDLSNAESLSSTPFSSA
DIVAQFVLPPINSGGVASGQFDVGSSTSTSTEANFGNHTNAANSFNMGSFSGQSKNYFTH
LTFDYGHDVFYAGATNKILKLNENLRVLSEAVTGPKLDAPQCHAGGCPEDVETSLVNNYN
KILVVSYAHNDGILISCGSIRQGACEIYNLLRFPSAPQFVAVPLAANDEYASTYAFVGPS
RYSWKEEDILYVGTTFTNVGDYRHDVPAISSRRLDDLNYAEFSIQQSIINIDVKYRDHFL
VNYVYGFNSSEYAYFVLVQKKSHLAEEAGYVTRLARICITDPNYDSYTEITIQCTATDEQ
IDYNILRDAKITHASQKLAHQMGIKRDDHVLVTVFSPSKEISDQPENKSAMCIYSLKDIE
DVFIENIHMCFNGTNKDRNLGYISGTINDGKCPNAGSLGNIYNFCSVGLKISGVAPITAH
ALFHFDNVSVTSVTATTTTDQQHSLAFLGTETGTIKKVLLSGQKPGEYEEIVVDAGNRIL
PNTMMSPKKDFLYVLSLRKITKLRIEHCSVYSNCSTCLESRDPFCGWCSLEKRCTVRSTC
QRDTSASRWLSLGSGQQCIDFESIVPDKIPITELTRVQLVIRTLPEPFNAKYRCVFGNST
PIDAEILEHGLACDTPPIDQRPIIAANMDHVLVPLSVRSSETNKDFVSRSFAFFDCSHHS
NCQSCVRSSWGCNWCIFDNKCVHKSEQCRNMENAIGGESQCPHLKRNRQPILLPVRVPKE
IRLEIENLPKPKSAHAGYLCTIQIEAAQMLLPAHIESNKIVVCEKTPYFYETNTHEYEAK
VEITWNRQHYVDTATVILYKCDVLGSHREHADCSLCVTRDPKYQCAWCGSSCVYNETCGS
LTTKMHGHGHGYDVGSVSNNVLLQNECPRPRIDIIKPLSGPVEGGTLITIEGSNLGIREE
DVRGKISIGTVPCILVNYQISVKIECRTGAALREMSAPIKVANDAGFTESSVQFHFKNVQ
LTGLYPTVGPKSGGTKLSLLGKYLNIGSSIRAFLDEYECHINVTQASSSRISCITSEATQ
PEPIRSLRLVVDGANRTFTCKNSDSGEQQQLISTSRSYYGTYHYNMPPPPCSIFNYTQDP
RIMQIKPLRSFASGGRILTVHGMYLDSIQNPELEVFLDNERVNKTSCTVINSSQMECPSP
PVNEKFQLLKNAIGLKSDQNFERKRKRNALFNDSLNMYATGSTVSSYFASNSMDVAAFVK
VHETQLNLQLSFIMDNVQLVRDLNKYFHEIRSTIVYLSDPKYLPFPNDGIKLYKGDSLVI
EGEMLNLAADEYDVNVTIGTVQCNITSLALTQLLCIPPEQQPASTDENGIDQSADLPLVV
VKVGRNLRFVIGYLKYDLNKPYSLSHAVLGIILTVAALIIILLIVLIIFRRKSTQAEREY
KRIQIQMITLESNVRSECKQAFAELQTDMTDLTADLESSGIPTLDHVNYIMKVFFPGVSD
HPILNSAKIRGNSHHTNYDTAMMQFEQLISNKYFLLTFIETLEMQRSSFSIRDRVNVASL
LMIVLMNKMEYATEILKSLLLRLIDKSLASKHPQLMLRRTESVVEKMLTNYLAICMYDYL
KEYAGSSLFLLFKAIKHQVEKGLVDAITHDARYSLSEERLLHEQVTHSVVILHILQDDLD
EKVQCRVNDWDTISQVKLKILDAIFKNTPFSMRPSVHEVDLEWRHGRGGHLTLQDEDLTT
KTINGWKRLNTLFHYGVKESAVMSLIARQNDSYNMPYSKQQAPYHNFYYINNSQSHIIIN
NDIESGLQQPRVYHLVKPIIPDHYMNIKNSAISGVLPPAQGGAHCIGNGSERVNKTIPEV
YLTRLLATKGTIQKFVDDFFSIILTVNEELPPAVKWLFDLLDEAARRHDIADTDIIHAWK
SNSLPLRFWVNFIKNPDFIFDVNKTYSVDSCLSVIAQTFMDACSTTEHRLGKDSPSNKLL
FAKDIPNYRRMVKDFYRDVARLPQISDQEMSTAMQQLSVQQNAEFDTISALKELYIYITK
YREQIMDALDSDPNCKKMHLSSKLESVAYTLDGEDTSNC
Download sequence
Identical sequences XP_017869284.1.65068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]