SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017875666.1.74565 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017875666.1.74565
Domain Number 1 Region: 90-545
Classification Level Classification E-value
Superfamily Sema domain 1.27e-125
Family Sema domain 0.0000374
Further Details:      
 
Domain Number 2 Region: 1433-1557,1808-1992
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.31e-41
Family p120GAP domain-like 0.034
Further Details:      
 
Domain Number 3 Region: 897-987
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000868
Family Other IPT/TIG domains 0.02
Further Details:      
 
Domain Number 4 Region: 1076-1147
Classification Level Classification E-value
Superfamily E set domains 0.000000000000364
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 
Domain Number 5 Region: 547-599
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000209
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 990-1075
Classification Level Classification E-value
Superfamily E set domains 0.00000000105
Family Other IPT/TIG domains 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017875666.1.74565
Sequence length 2028
Comment PREDICTED: plexin-B [Ceratina calcarata]; AA=GCF_001652005.1; RF=representative genome; TAX=156304; STAX=156304; NAME=Ceratina calcarata; AL=Scaffold; RT=Major
Sequence
MRFLGFVSFPTSPTVSSLKLLLPIHRLSLSSMYVATWFLVVLVTATIDTPASTVSPVKEN
KSLHIVSQFPPGDGQRYGFYPIDPNTTREGALRFNHLTIDPSTGRLYAGAVNRLLELDSD
LKLEEYVSTGPRLDNPQCHATGCNSRDITTSLMDNVNKLLIADLESQTLIACGSLLQGAC
EKYKMSNISVKPEFVPLSVAANDENSSTYAFIGPERYNAWGQTNILYVGTTFTNRGDYRH
DVPAISSRSLDNLEFAEYTFNKQSIVYIDVKYRDHFLVKYVYGFNASDYAYFVLVQKQSH
LPEEEEKGYISRLARSCISDPNYDSYTEVTLQCVVDLGDGKLQSYNLVQDAKVAAAGSDL
AKQLGISVGDPIFVSVFSPSRGITNEPLSRSALCVYSLEDIERTFNENIHMCFNGSTKYR
NMGYVSGPIQDGKCPTAGTTGNILNFCEVGLKISGMSPIVGKAILHFPEEFITSVTVTTT
ESHTVAFLGTNEGVLKKVLLFGDGAFVYESITIDEGSRLMPDTLISPNTKHIYVLSSSKI
SKVKIEHCNSYTNCSTCLDARDPYCGWCSLEKRCTIRGDCQKASHSSPRWLSLGTGQQCI
DFEQVLPDRMPINQMTTVHLTIRTLPELPAGANYKCVFGNAEPIDALMTGFGLSCPTPPV
TERPSIPEGADHVLVPLSVRSSETNKDFVSRNFAFFDCSRHTMCTECVKSQWACSWCVYD
NKCTHNTSCQGIISGENVSNQASLAAHGAQYCPRFVQRQEPLMLPNSVPKEIVLEVENLP
HPQVGHSGFQCIVSIEGANLKVQARVDSSRYIVCDKTVYSYEAVTGEYEAEVTVVWNINH
HVDKTTIILYKCEVLGSHREHADCSLCVTRDARFECTWCGNSCVYRHSCLHSPFTECPKP
RIDMIKPLSGPIEGGTLVTIEGSNLGLKESDVEGKIHIGNTPCALVDYEVSVRIVCRTGR
HEATDTASVVVGNDAGYTESSVLFNYKDIRLSGLYPSVGPQSGGTQLAITGMYLNIGSTI
SAYLDDLPCHVNATQASSTRLTCVTSKSDRVRKIERLTLSIDGANRTLVGNPYNYTHDPT
IMEIKPLTSFASGGRMITVHGTNLDTIQKPEMEVYFDNEPLPVNRTVCTVLNPTQMECPS
PSVAKRFMSLRRNTRSAVNVQSVPPQSLKLKESQLSLKIAFIMDNVESVRDLEKHFKSLR
NRLLYVEDPKFFAFPRNIKLYKGDTLVIEGENLIYASDESDVNVTVGIMPCNVTSLALTQ
LVCIPPDQQPEDTDELGIKTENGLPLVVVRVGRSLRFPIGYLRYEVIKSYPIPPEAIAGI
AAGTFGLVFLFVLVLIIYRRKSTQAEREYKRIQIQMDTLESNVRMECKQAFAELQTDMTD
LTADLESSGIPTLDHKNYIMKVFFPGVTHHPILNDPRSRSNVSRTNYDAAMIQFEQLINN
KYFVLTFIETLEAQKDFNIRDKVNVASLLMVVLMGKMEYATDILMNLLLRLIEKAVNTKH
PQLMLRRTESVVEKMLTNWMALCMYNYLKDYAGSSLFLLFKAIKHQIEKGPVDVITHDAR
YSLSEERLLREQIEHSVVTLHIVQDDLDEKIQCKVLDCDTINQVKSKILDALYKNTPFSL
RPSVHDVDLEWRHGRGGHLTLQDEDLTTKCSGEWKKINTLAHYGVKESAVMSLIPRQNDG
FSVACKPPCHNCKPSHYHHQQQSIHHHPHHHHLHRHANHCSSTHLPSTPNHNLISPVMYN
HPVSGLYFESQHSPPIITANGDVESGHGGNQRLYHLVRPIEDSHYPPGMGFTGSKHHHPE
RTHKAIPEIFLTRLLSTKGTVQKFVDDFLNTILTANEALPSAVKWLFDLLDDAAKQHGIV
DPEVPHAWKSNSLPLRFWVNFIKNPDFMFDINKSTTVDSSLSVIAQTFMDSCSMTEHRLG
KDSPSNKLLFAKDIPHYREKVGRFYLDVQRLPQITDQEMSSAMQQLSASHANEFDVIAAL
KELYIYVSKYYEQILEALETDAGCRKLHLAHRLENVACTLEGEETSAC
Download sequence
Identical sequences XP_017875666.1.74565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]