SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_017890227.1.74565 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017890227.1.74565
Domain Number 1 Region: 575-635
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-16
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 145-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000106
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 319-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000169
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 4 Region: 492-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000964
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 629-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000443
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 546-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000183
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 7 Region: 433-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000357
Family Classic zinc finger, C2H2 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017890227.1.74565
Sequence length 1082
Comment PREDICTED: zinc finger protein 16 isoform X1 [Ceratina calcarata]; AA=GCF_001652005.1; RF=representative genome; TAX=156304; STAX=156304; NAME=Ceratina calcarata; AL=Scaffold; RT=Major
Sequence
MDVAGDLTLQWVEEVGNVIHEEVICGLEAQLVGAEEEVIGACEEVAIEETVETVPDVTSA
ADSEILMVPQSNDMESIYIVPQDQGHDYLNIQVTEEVIADNDWDRSGPDDGVEISEEKVS
HEHLLEYDDMEIPLPIDQDSYTNSRPYPCDFCSRRFRKKANLMNHMVAHQTDRPHGCNLC
GARYARKCDLMNHLKIHAYAPSRDGLEDDLNDDDDSLVPEEEEPIKGRRKKVQSSVPRKR
KNNSAVPKRTMDAAKMEMGKYVNKSYDYVDEDTRLLEEMTSRNSARSGNYASSSRWTEQM
SPVTAEPQQPRWPVTDPTKPYVCQFCGVGFAREKALASHARIHGGDSPFECTSCGDMFWD
VNSLREHVRMKHGGTVQPDFEEYDNDTTYTGDERFGEFYCNTCGVPFHRLDLLKRHQKIH
VKQETDMVEGPSQHHVCNVCGEWFEEALALLAHAELHARSPSRRCLLCGERCRDDAEVAE
HVRQNHAEDAPPNTCTFCGKTCKDKRSLLKHAWVHNVDKTFGCTKCGKRFHSKARLRRHM
VSHRNKMVACDECGEEFPDGRALVSHRHSHNKDLGGRSFPCRECGKTFGSRSSQQIHIRI
HTGERPYGCRFCWKAFADGGTLRKHERIHTGEKPYGCAICPRAFNQRVVLREHVRAHHSG
PDPKCVGSITPYLCKVCGDAYGTSEEIVAHIVQHCDDNTALRRQPQTGPRKYKRRRKLKP
HETNTVAVRMPEQFEMVEAPSDSDDNTKRKLGRKNKQQHRSNVEEGYQNVLKSFESSLQN
INSIVSNSKLNPGKSKLSKKKMRKEEKKNEAQSSCQPGRPKMIHTQKTRVPVEMGSDGVK
KGQKTKTMVTRTPKMIPQEHKSGVFPGGERNRPRTKNVSYHIEGKYQPTPATFPKPKEEI
PPASAQVLPNVKMEANLQKASNNNHRSNNGNVLGVNNEKIEPTPRKRAGVGRKVKKQIKQ
EPMDIEEEIIQDNNNTENSDAARLMDHSMDGNNLEVAFEASVTTEEEAILPHVGNPEDVG
TGNVKLSVKVESTPQRMLAVHMTPVDDIPETIIPDALEYTCEMCSAVFSSRAELLVHVPI
HI
Download sequence
Identical sequences XP_017890226.1.74565 XP_017890227.1.74565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]