SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017890618.1.74565 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017890618.1.74565
Domain Number 1 Region: 33-90
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000837
Family EGF-type module 0.0019
Further Details:      
 
Domain Number 2 Region: 76-123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000147
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 3 Region: 2-47
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000439
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 4 Region: 117-146
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000911
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017890618.1.74565
Sequence length 146
Comment PREDICTED: fibrillin-3-like, partial [Ceratina calcarata]; AA=GCF_001652005.1; RF=representative genome; TAX=156304; STAX=156304; NAME=Ceratina calcarata; AL=Scaffold; RT=Major
Sequence
MHGVCGNGTCRNTPGNFQCDCNPGYRSSDIMKICMDINECEETPGLCRGGNCINTEGSFK
CQCPPGHELGPDKQSCKDIDECSRTSGICSNGVCENMMGTYQCICDDGYQQTGLKSHCED
INECATNNGGCEDICLNTPGSFSCSC
Download sequence
Identical sequences XP_017890618.1.74565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]