SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017909191.1.57651 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017909191.1.57651
Domain Number 1 Region: 527-746
Classification Level Classification E-value
Superfamily Bet v1-like 4.12e-40
Family STAR domain 0.0054
Further Details:      
 
Domain Number 2 Region: 97-246
Classification Level Classification E-value
Superfamily PH domain-like 1.46e-27
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017909191.1.57651
Sequence length 755
Comment PREDICTED: collagen type IV alpha-3-binding protein isoform X3 [Capra hircus]; AA=GCF_001704415.1; RF=representative genome; TAX=9925; STAX=9925; NAME=Capra hircus; breed=San Clemente; AL=Chromosome; RT=Major
Sequence
MQHSGAPIQPSPFSAPPTLLPGVTREGRRGPNLGGGAGRSAGVTATATADGWKGRLPSPL
DLLPRSARCQARRRRRRRRGGRTPSLLPLPPAPERALLPSPSPDPSPRGLGASTGAAQGA
GAGLLLGCRASMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKN
NTLSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWI
DAIEQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRD
ILCRQVDTLQKFFDACADAVSKDEFQRDKVVEDDEDDFPTTRSDGDFLHNTNGNKEKVFP
HVTPKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRMDKETEKRRRVEE
AYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHW
STSMTSGDAFSSVGTHRFVQKPYSRPSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYSL
QDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRN
DWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSAIRQIPALNENDPETWIVC
NFSVDHSSAPLNNRCVRAKINIAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWA
PASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences XP_017909191.1.57651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]