SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_017917760.1.57651 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017917760.1.57651
Domain Number 1 Region: 55-168
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-28
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 2 Region: 263-377
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000262
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 466-503
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000038
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 176-213
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 222-262
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000982
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 427-464
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000196
Family LDL receptor-like module 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017917760.1.57651
Sequence length 654
Comment PREDICTED: low-density lipoprotein receptor-related protein 3 isoform X4 [Capra hircus]; AA=GCF_001704415.1; RF=representative genome; TAX=9925; STAX=9925; NAME=Capra hircus; breed=San Clemente; AL=Chromosome; RT=Major
Sequence
MEKRAAAGPEGAPGARAQLAVVCLVNIVLTGRFSSAVPALGEASASQPPLLTAACSGQLE
RHTARRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLMLGP
AAPPRQEAFRLCGSAIPPAFISARDHVWIFFHSDTSSSGQAQGFRLSYIRGKLGQASCQA
DEFRCDNGKCLPGPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCL
PAERRCDGTQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDT
QDPRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYH
ARARSAGHGFNATYQVKGYCLPWEQPCGSSREGDAEDPGEQGCFSEPQRCDGWWHCASGR
DEQGCPACPPDQYPCEGGSGLCYTPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCI
FETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQ
EYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQPPPHPPGLGATEP
AHGHAATDAQTRLPPRALPPPPRPPLEPAVSPAAGAARADPAADGRAHLPDRAG
Download sequence
Identical sequences XP_017917760.1.57651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]