SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017920490.1.57651 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017920490.1.57651
Domain Number 1 Region: 34-410
Classification Level Classification E-value
Superfamily RNI-like 3.92e-56
Family Cyclin A/CDK2-associated p19, Skp2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017920490.1.57651
Sequence length 438
Comment PREDICTED: F-box/LRR-repeat protein 20 isoform X2 [Capra hircus]; AA=GCF_001704415.1; RF=representative genome; TAX=9925; STAX=9925; NAME=Capra hircus; breed=San Clemente; AL=Chromosome; RT=Major
Sequence
MAPSRDRLLHFGFKATMFSNSDEAVINKKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVL
ALDGSNWQRIDLFDFQRDIEGRVVENISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRN
IEVLNLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISW
CDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEG
LITICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNC
HELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEV
IELDNCPLITDASLEHLKSCHSLERIELYDCQQITRAGIKRLRTHLPNIKVHAYFAPVTP
PPSVGGSRQRFCRCCIIL
Download sequence
Identical sequences A0A1S3WLV1 A0A1U7QC83 A0A287B793 A0A2I2ZFC9 A0A2J8W9V5 A0A2K5EWV9 A0A2K6DQ54 A0A2K6Q4D1 A0A2K6S1T4 F7HC13 H2QCU2 J3KTA1 L8IEY6 M3WL07
ENSP00000462878 ENSP00000462878 9913.ENSBTAP00000040781 ENSP00000377832 NP_001030268.1.59421 NP_001030268.1.76553 XP_003466964.2.53824 XP_004764725.1.14098 XP_004859566.1.39548 XP_005075980.1.91757 XP_005624618.1.84170 XP_005653993.1.46622 XP_006068609.1.26621 XP_006924775.2.64745 XP_006940355.1.62641 XP_007085837.1.5354 XP_007112613.1.24612 XP_007618498.1.28591 XP_008011061.1.81039 XP_008521483.1.77740 XP_008995730.1.60252 XP_009430553.1.37143 XP_010340104.1.74449 XP_010377617.1.97406 XP_010840974.1.44457 XP_011382597.1.92234 XP_011723628.1.29376 XP_011997282.1.54773 XP_012041419.1.66739 XP_012307360.1.9421 XP_012621372.1.48125 XP_014646229.1.5094 XP_014689023.1.49734 XP_014934061.1.86478 XP_014975015.1.72884 XP_015103440.1.17985 XP_015862790.1.50099 XP_016020119.1.101085 XP_016047114.1.11023 XP_017920490.1.57651 XP_018882236.1.27298 XP_019271546.1.44245 XP_019652630.1.58354 XP_020757428.1.74333 XP_021579858.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]