SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017922712.1.57651 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017922712.1.57651
Domain Number 1 Region: 56-552
Classification Level Classification E-value
Superfamily Sema domain 5.89e-100
Family Sema domain 0.0018
Further Details:      
 
Domain Number 2 Region: 1416-1541,1707-1863
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-34
Family p120GAP domain-like 0.028
Further Details:      
 
Domain Number 3 Region: 984-1074
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000504
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.05
Further Details:      
 
Domain Number 4 Region: 893-984
Classification Level Classification E-value
Superfamily E set domains 0.000000000000205
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 5 Region: 1072-1152
Classification Level Classification E-value
Superfamily E set domains 0.0000000000682
Family E-set domains of sugar-utilizing enzymes 0.065
Further Details:      
 
Domain Number 6 Region: 555-607
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000576
Family Plexin repeat 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017922712.1.57651
Sequence length 1931
Comment PREDICTED: LOW QUALITY PROTEIN: plexin-D1 [Capra hircus]; AA=GCF_001704415.1; RF=representative genome; TAX=9925; STAX=9925; NAME=Capra hircus; breed=San Clemente; AL=Chromosome; RT=Major
Sequence
MARRAAGGAPLSARAAAASPLPPRPPFRAPQCPPPPPPLWLLLLLGAARVGALEIQRRFP
SPTPTNNFALDGAAGTVYLAAVNRLYQLSGANLSLEAEAAVGPVADSPLCHAPQLPQASC
EHPRRLTDNYNKILQLDPGQGLVVVCGSVYQGFCQLRRRGNISAVAVPFPPAAPPAAPVT
VFPSMLNVAANHPNASTVGLLLPPAAGAGGSRLLVGATYTGYGSAFFPRNRSLEDHRFEN
TPEIAIRSLDARGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVRAFLHPPDPRPGAQ
TYAYLALNSEARAGDKESQARSLLARICLPRGAGGDAKKLTESYIQLGLQCAGGAGRGDL
YSRLVSVFPTRELLFAVFERPQGTPGARAAPAALCAFRFADVQAAIRAARTACFVDPAPD
VVAVLDSVVQGTGPACERKRNIQLQPEQLDCGAAHLQHPLSVLQPLKALPVFRAPGLSSV
AVASVGNYTVVFLGTVSGRLLKVNLNESMQVVSRKVVTVAYGEPVHHVMQFDPVDPGYLY
LMTSHQMARVKVAACAVHTTCGDCVGTADAYCGWCTLETRCTLRQDCANSSQPHFWTSAS
AGPSRCPAMTVLPAEINVHQEYPGMILQISGSLPSLSGMEMACDYGHGIRTVARVPGPAF
GHQIAYCNLLPRDQFPPFPPHQDHVTVEMSVRVQGQSIVRASFTIYDCGRVGQVYPHTAC
TSCLSAQWPCFWCAQQHACVSNQSRCEASPNPTSPQECPQILPSPLAPMPTGGSQSIPVH
LASAAFFQGAALECSFGLEETFEAVWVNESAVRCKQVVLHTTQKSQVFPLSLQLKGRPAR
FLDSPDPMTVEVYNCAVGSPDCSQCLGREDLGHLCVWSDGCRPRGTMQPLPGTCPAPEIR
AIEPLSGPLDGGTQLTIRGRNLGRRFSDVAHGVWIGSVACEPLADRYTVSEEIVCATGPA
TEAFSDVVTVNASKEGRSQERFSYVLPLVHSLEPXMGPKAGGTRITIHGSDLHVGSELQV
LVNNTEPCTELLRSDASIACTVPGGSLPAVVPVCVRFEQRGCVHGGLSFQYMPNPVITAI
SPHRSHVSGGRTITVAGERFHMVQKVSMAVHHIGREPTLCKVLNSTLITCPSPGALSNAS
APVDFFLNGRVYADEAVVAEELLEPEEAQRGSQFRLDYLPDPQFSTAKREKWIKHHPGEP
LTLVIHKEQDGLGLESHEYRVKIGQVACDIQIVSERVIHCSVNESLGTAEGQLPITIQVG
NFNQTIATLQLGGSETAIIVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEM
ESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLP
SQTLNSQGSSPVQETHPLLGEWKIPESCRPNMEEGISLFSSLLNNKHFLIVFVHALEQQK
DFAVRDRCSLASLLTIALHGKLEYYTGIMKELLVDLIDASAAKNPKLMLRRTESVVEKML
TNWMSICMYSCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAK
PRNLNVSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASS
TQSYILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLTDKKDNTLGRVKDLDTEKYF
HLVLPTDELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPP
LAVKYFFDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIEKTDHIDAC
LSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIHDMTPLSEQEMN
AHLAEESRKYQNEFNTNVAMAEIYKYAKRYRPQIVSALEANPTARRTQLQHKFEQVVALM
EDNIYECYSEA
Download sequence
Identical sequences XP_017922712.1.57651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]