SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017945756.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017945756.1.99540
Domain Number 1 Region: 13-241
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.4e-84
Family Eukaryotic proteases 0.000000609
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017945756.1.99540
Sequence length 243
Comment PREDICTED: uncharacterized protein LOC496623 isoform X1 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MKLFLLCVLLGAAAAFDDDKIIGGATCAKNSVPYIVSLNSGYHFCGGSLINNQWVVSAAH
CYKASIQVRLGEHNIALSEGTEQFISSSKVIRHSGYNSWTLDNDIMLIKLSSAASLNAAV
NAVALPSGCAAAGASCLISGWGNTLSSGSNYPDLLQCLYAPILTDAQCNNAYPGEITNNM
ICLGFLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAQRNYPGVYTKVCNYNSWIQSTI
AAN
Download sequence
Identical sequences Q5M976
NP_001011199.1.99540 XP_017945756.1.99540 gi|56541161|gb|AAH87563| gi|58332102|ref|NP_001011199|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]