SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017950180.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017950180.1.99540
Domain Number 1 Region: 137-381
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.77e-71
Family Nuclear receptor ligand-binding domain 0.000000000603
Further Details:      
 
Domain Number 2 Region: 27-115
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-28
Family Nuclear receptor 0.00000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017950180.1.99540
Sequence length 383
Comment PREDICTED: thyroid hormone receptor beta isoform X2 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MPSSMSETEETKPGHLGYIPSYLDKDELCVVCGDKATGYHYRCITCEGCKGFFRRTIQKN
LHPSYSCKYEGKCVIDKVTRNQCQECRFKKCIAVGMATDLVLDDSKRLAKRKLIEENREK
RRKDEIQKSLVQKPEPTQEEWELIQVVSEAHVATNAQGSHWKQKRKFLPEDIGQAPIVNA
PEGGKVDLEAFSQFTKIITPAITRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAA
VRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGVSLSSFSLDDTEVALLQAVLL
MSSDRPGLTSVERIEKCQEGFLLAFEHYINYRKHNIAHFWPKLLMKVTDLRMIGACHASR
FLHMKVECPTELFPPLFLEVFED
Download sequence
Identical sequences B3GR08
XP_017950180.1.99540 gi|189514199|gb|ACE07029| gi|302954166|gb|ADL74877|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]