SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017951269.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017951269.1.99540
Domain Number 1 Region: 32-138
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 2 Region: 310-410
Classification Level Classification E-value
Superfamily SRCR-like 1.05e-34
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00018
Further Details:      
 
Domain Number 3 Region: 418-534
Classification Level Classification E-value
Superfamily SRCR-like 3.53e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0011
Further Details:      
 
Domain Number 4 Region: 175-288
Classification Level Classification E-value
Superfamily SRCR-like 1.18e-21
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017951269.1.99540
Sequence length 755
Comment PREDICTED: lysyl oxidase homolog 4 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
mdaymstlglfiatlvcllelccaqrqagtpqiqlrlagssrvpnegrlevfyngiwgtv
cdddfsievahvvckqlgfemamnwahsakygqgegtiwldnvrcsgtetsitecesngw
gisdcrhtedvgvlcstsrirgseqaqaiavqytkkieevrikpilarakasvpvtegiv
evkhkgrwrqvcdhgwtahnnrvicgmlgfpgeikpneqfyrklwnlklkvpksrlktls
krkmfwihkvsctgnephlshckvqvsppnlkpackngmhaivkcvappsvsnghgnnyq
kafrtmeplvrlrsgphpgegrvevlkngkwgtvcddkwnlisasvvcrelgygsakeai
tggqlgqglgpihmnevlctgqeksiteckfkearlagcqheedaavrcnmpdmgyskqv
rlsggrsneeglvevlmdvkgvkkwgticgeqwgmneaivacrqlglgfashalqetwyw
rgtpgagevvmsgvrcsgtemsvqqcrhhsvvhcprgggrysagvtctehapdlilnaql
vqesayledrplsmlecaheeeclsssaddmawpyghrrllrftsqihnngradftprng
rhtwvwhechrhyhsievfthydlltmngtkvaeghkasfcledsncgkgiqrryecanf
geqgitvgcwdsyrhdidcqwvditdvlpgdyifqvilnpkfevaesdfrnnvmrcrcky
dghriwmhnchtgdafsadleesfehqlrlsnnlv
Download sequence
Identical sequences gi|301614001|gb|XP_002936486| XP_017951269.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]