SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017955297.1.46654 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017955297.1.46654
Domain Number 1 Region: 486-648
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 9.29e-65
Family A middle domain of Talin 1 0.0000408
Further Details:      
 
Domain Number 2 Region: 2279-2471
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.62e-51
Family I/LWEQ domain 0.00014
Further Details:      
 
Domain Number 3 Region: 657-779
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.16e-49
Family I/LWEQ domain 0.0000843
Further Details:      
 
Domain Number 4 Region: 749-885
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.14e-42
Family I/LWEQ domain 0.0002
Further Details:      
 
Domain Number 5 Region: 1831-1962
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.73e-32
Family VBS domain 0.00033
Further Details:      
 
Domain Number 6 Region: 1215-1351
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.62e-31
Family VBS domain 0.012
Further Details:      
 
Domain Number 7 Region: 203-317
Classification Level Classification E-value
Superfamily Second domain of FERM 3.66e-30
Family Second domain of FERM 0.0000084
Further Details:      
 
Domain Number 8 Region: 318-408
Classification Level Classification E-value
Superfamily PH domain-like 1.76e-25
Family Third domain of FERM 0.0000536
Further Details:      
 
Domain Number 9 Region: 1072-1197
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000000439
Family alpha-catenin/vinculin 0.031
Further Details:      
 
Domain Number 10 Region: 1997-2121
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000188
Family VBS domain 0.015
Further Details:      
 
Domain Number 11 Region: 941-1041
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000628
Family I/LWEQ domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017955297.1.46654
Sequence length 2836
Comment PREDICTED: talin-2 isoform X3 [Drosophila navojoa]; AA=GCF_001654015.1; RF=representative genome; TAX=7232; STAX=7232; NAME=Drosophila navojoa; AL=Scaffold; RT=Major
Sequence
MSTLSLRIQLEGGRVTKTIQFQPNTTVFDACKIIRDKFAEAVQGQPSEYGLFISDEQNQQ
GVWLEAGRTLGYYILHNQDTLEYRRKLRTLRVRMLDGAVKTILVDDSQPVSQLMVVICTK
IGITNHEEYGLVREDNEAQNENLPDNKFATLTLKRKFTEKDRDAKMESLRKKLKTDDEMN
WVDVGRTLREQGIDESETVLLRRRFFFSDQNIDSRDPVQLNLLYVQARDAILDGTHPVTQ
DKACEFAGIQVHIQFGPHNEAKHKPGFLDLKDFLPQSYVRVKSIEKKIFAEHKKHYDLTE
IDAKVLYTKTARELPTYGVTFFLVKEKMNGKNKLVPRLLGVTKDSVLRLDERTKEILVSW
PLTTVRRWGASPNTFTLDFGDYANQYYSVQTTEAEQIVQLIAGYIDIILKKKQTKDHFGI
EGDEGSTMVEESVAPSKATFLQHETNRVEKLNLESLAHPGIMRPYDENGHAQFHKTKEVR
ISSVNLTEPQRALIGYISAGQDVLIRADEELRTKAPIQELGSDLRSIEWRENTLDTSKQA
VSSHVATMSAATAQIITASQPDEVDTEAISASVSQIAQTIPEVTKEVRLIAALMENDTNG
DQLLEAARNLCNAFSDLLKAAEPESKEPPQHLINAATRVGEATTHVLSTIAEEEAPENRD
LHDMLVDLGKAVANTTAALVLRAKNIAASCEDDQARNRVIAAASQCALATSQLVACAKVV
APTLHNAACREQLEAAARNVARAVNSLCEVCNEASTDPKLKADLMDAARDVSKSLLDMLE
HVKLSTREHAHRTSQELSPVENVIIGTDVLVSTNDPQEMVRHARTLGQTTAQLIQSIKGE
ADQQEDADMQRRLLSAAKQLADATAKLVEAARLCSSNPHDSDNQNALRRAAEELREITTS
TANTPAMKRGLIQRLEYHSKLAASAATQCISAAQNAVQHSQDHQTKESLLQDCKRVADTI
PRLVTSVKTTRAQPDDAHAQLNLIEAAEQFIEPALQVSKSSRALRPTVTDIPSATQLSKS
ALHLGQAVSELHSVAQRARDACGGQELESALEAVRKLHHVLDDTRQAALAGQLRPLPGET
VENTADELRKSAKNVGIALSQLLSSVLQGQRQYAGAAGRDTALALGEFTKSVHGVAATTQ
NPTIIDCADDVVTSSAQLIEQAQRTLKGVSDPQALTQAGRDVTGALSRTVDCIPGQREVD
AALRNVSDLSEILSVSEFPPSNRPYAELQSELKQVAEQLSTAGGQIVQSYASPALLADSS
QQFAANYRDLLSVSMQMAGQAQTDEPVRSQMIDSLRNVSTQSCSLLSTAKSIAADPGQPN
AKNLLLAAARSVTESINQLVDASIQSAPGQKECDNAIRNIDALRRMLDYPHEPINEMGYF
DCVEQATAKSRNLGYAISEMINNAKQSQHVEFSQSVNNVNESIQGLMESSSQAAYLIGVS
HPSSVAGRPGIIDQAQLTWAYQGIRQHCDIVSSPQSGKPQMISALTVIAKHTSYLCSICR
QASMNTNNPVAKNEFIVLAKQVATATSDLVQDIKAIEENPTGGNRDRLVEPLLEAVKAVR
QYASSPEFISIPAKISAEGRKAQEPVIQAGRGVIDGVVEMVKAAKSLALTPDNPPVWQQL
SMHSTPVSESVKRLVDNIRDKAPGQAQCEQVLHTLGTCTRELDSCALAANAQGLSRRRDN
NLHGFSGQTMNAAAELLDKLEPIRVAGKNNAEQLGHAVGEISRYVVPMVNGAIGACTHIV
HSQQQMSLINQTKSVVESAITLVQSAKDSAGNPRATHAHPRLDEAIDGTREAIQELQQAV
EKINAETGIVTGLMEQVNRAITRLTDKRQSLLNASYSDSFVDYQTRMVATAKEIARLGNE
MNAKSSVEPAVLPQLAVEMTQHYQLLTQDSVGASTTTTSPDVAMRIRSTVIDLGRSISSM
IQSSAGGASPNDASAQKEIARNAREVSEKVAQVLAALQAGSRGTQACINAAHTVSGIIGD
LDTTIMFATAGTLHSDGDGSFADHREHILQTAKALVEDTKVLVTGAAGTQDQLANAAQNA
VSTITQLAEAVKRGACSLGSSQPDSQVMVINAVKDVASALGDLINCTKLASGKPIHDPSM
QGLKESARVMVLNVSSLLKTVKAVEDEHTRGTRAMEATVEAISQEMRAMQTPPPVGSAQV
GPEDLIRVTMNVTAATAKAVAAGTSNLQADIVAAANLGRRAISDMLMVCRSVAWNCAETD
ELRVRTLEAGTSVAESYRELLNGILHNCSADDRMHLSRRVAKCVTDLVAMARLLKGSDWI
DPEDPTVIAENELLGAAASIDAAAKKLASLRPRRQADVKIELDENMKFDEMILEAAKGIM
GASAALVRAANAAQRELIDQGKVARRPLTSSDDGQWSEGLISAARLVAAATHSLVEAAQN
LVRGVGTEEMLISTAKQVAASTAQLLIACKVKSNPNSEAGRRLQAAGNAVIKSTDNLVHA
AQQGLEAEEEHSLKINTSMVDGMAQEINARSAVLRKEKELEEARQRLKHVRQAQRYAKNT
QGFTTDESDTEYAYGTLNRSQNNTLGRGGGAYYGSQSGDLPSSPSYYTGSGAGSQQKHHY
NYASPQPQHFHHPGAVSPPPSNYAVMDDVNGDFPPPPPPLSTTISNMQTATSTHSFRSNP
KLTANAVPRPYPGSPVGGAGSNGFTTISASTPTNANNYQQSFESSSIKTQNSSTSGAPPT
VPPPPPQKPTGNRNLEACVQDLHDKTFGQGGVVEITGGNAYPGQNYEGYTSSRYETRNFD
KTANTSSNSESGLVKPLESSFSQMTLNTDGGKISIVDQGSERLTSMTQRVMERKSFTTTT
ESRSETKTEKHSFRLE
Download sequence
Identical sequences XP_017955297.1.46654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]