SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017962713.1.46654 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017962713.1.46654
Domain Number 1 Region: 72-523
Classification Level Classification E-value
Superfamily Sema domain 8.5e-132
Family Sema domain 0.0000462
Further Details:      
 
Domain Number 2 Region: 1393-1522,1731-1892
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.02e-44
Family p120GAP domain-like 0.047
Further Details:      
 
Domain Number 3 Region: 885-979
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000126
Family Other IPT/TIG domains 0.009
Further Details:      
 
Domain Number 4 Region: 978-1066
Classification Level Classification E-value
Superfamily E set domains 0.00000000000154
Family Other IPT/TIG domains 0.062
Further Details:      
 
Domain Number 5 Region: 526-577
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000183
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 1085-1167
Classification Level Classification E-value
Superfamily E set domains 0.0000000742
Family E-set domains of sugar-utilizing enzymes 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017962713.1.46654
Sequence length 1949
Comment PREDICTED: plexin A3 [Drosophila navojoa]; AA=GCF_001654015.1; RF=representative genome; TAX=7232; STAX=7232; NAME=Drosophila navojoa; AL=Scaffold; RT=Major
Sequence
MNILICCVIPITIFGISSVSASSLLGNGLTSWTQREDRIKRSASALKINLAETDLNVGYL
NSSSSNVITHVARFDTTLNHLLVDTITGRVFVGGVNRLYQLSPDLELHETVKTGPQNDSV
ECTILDCPLNAIRKPTDNYNKVLLIDRATSRLIACGSLFQGTCTVRNLQNVSIIEHEVPD
AVVANDANSSTVAFIAPGPPQHPVTNVMYVGVTYTNNSPYRSEIPAVASRSLEKSKMFQI
ASSAVTTGTRTFINSYARENYLVNYVYGFSSERFSYFLTTQLKHSHHSSPKEYITKLVRI
CQEDSNYYSYTEIPVECISEAQGGIKFNLVQAGFLGKPSLDLAQSLGISIQDDVLFAVFS
KGESNTPTNSSALCIYSLKSIRRKFMQNIKFCFNGNGMRGLDFISPSMPCVLTKLQTIGE
DFCGLDVNSPLGGEQPITAVPVAMFNTLLTSVAATSTSGYTVVFIGTVDGYIKKVVVESS
TVANEYASLAVDVGSPIKQDMQFDNQNLYVYAMSDRKVSKVKVYDCADFKTCGECLGARD
PYCGWCSLENKCSPRSNCQDDANDPLYWVSYKTGKCTTITSVVPHQLQRTTARTLELIID
HLPQLKENLICAFTTEDKALFTNATKKRNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTR
NGPDLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRI
GPSYRSGPGFCPTINATGDGSEVLVAAGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVT
SLNAQLLGDTIYCDSMEFQYTSRSPNLTATFAVIWGGSKPLDNPHNIHVVIYRCRDMADS
CGICLALAEKYNCGWCSSTNTCEVVEQCNKNNEGKTDWLNRSEICPNPEIHSFEPKTGPW
EGGTNITIKGINLGKNYNDIYSGVRIAGINCMPFQQFYIDTKQIVCTVDSPGEQMYRNGR
IVVQIGDYRGESKEDYEFVDPKISNFYPRFGPTSGGTQIRIIGKHLNAGSRIQAYINDHL
PCKIISTDSSQAICRTSPSPGIIEGRLKMSFDNGPREFNDYNFKYVLDPTVEHVSSGPSA
QIKIPKGIPAGGIRIVVTGTQFTSIQAPSIYVLYKGQMYASQCRVHSDTEMKCPSPVIEA
DSQTLDPDNPTLLEYGFLMDNVLKVQNLSRKHNNHFELYPNPEYFAFEERVKYFKSEYLT
INGRNLDRACKETDVEVKIGNGFCNITSLSRQQLTCRPPTEASAASNSPSGPEVIVRIGS
SLEYRIGILSYESSNLIMDWGDNVVFVVIAGCVIFLLIFVALLVAYRKKTSESNRVLRNM
QEQMDILELRVAAECKEAFAELQTEMTDLTGDLTSGGIPFLDYRSYAMKILFPNHEDHNV
LQWEKPELLRKEKGLRLFAQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSK
LEYCTDILKTLLSDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKECAGEP
LYMLFRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRAMTVNASIIQQPIFCNNLD
MLPSHTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSQRPRKDDLDLEWRTGATGRVILY
DEDATSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSIYNFSILSDKNEKSHKYETLNIS
KYTSSSPTFSRAGSPLNNDMHDNGIKYWHLVKHHDSDIQKEGERVNKLVSEIYLTRLLAT
KGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQALLHGITDPEVVHTWKSNSLP
LRFWVNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDI
PEYRKWVDRYYRDIRDMSSISDQDMNAMLAEESRLHTTEFNTNCALHELYTYAVKYNEQL
TVTLEEDEFSQKQRLAFKLEQVHNIMSAE
Download sequence
Identical sequences XP_017962713.1.46654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]