SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018019925.1.64131 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018019925.1.64131
Domain Number 1 Region: 99-554
Classification Level Classification E-value
Superfamily Sema domain 4.32e-121
Family Sema domain 0.000023
Further Details:      
 
Domain Number 2 Region: 1436-1567,1788-1942
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-43
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 1006-1095
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000344
Family Other IPT/TIG domains 0.041
Further Details:      
 
Domain Number 4 Region: 558-609
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000667
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 5 Region: 912-981
Classification Level Classification E-value
Superfamily E set domains 0.000000000471
Family Other IPT/TIG domains 0.0094
Further Details:      
 
Domain Number 6 Region: 1116-1199
Classification Level Classification E-value
Superfamily E set domains 0.0000000154
Family E-set domains of sugar-utilizing enzymes 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018019925.1.64131
Sequence length 2006
Comment PREDICTED: plexin A3-like isoform X2 [Hyalella azteca]; AA=GCF_000764305.1; RF=representative genome; TAX=294128; STAX=294128; NAME=Hyalella azteca; AL=Scaffold; RT=Major
Sequence
MRASHKAAGGESASPTAPKDDSGGGGGADSMSAIGADAPHRIAPTRTRASASMIDPKRHL
LWYSYISFAMLALLMVASSASALMAEATHDSLFIVERFEDEEWQSFQHIAVDKSSGNVYA
AGVNRLYQLDLNLNLIQTVVTGPIDDAMQCSATGCAGDAIKAMKPTDNINKVLLLDYLRA
RVIVCGTVRQGSCQVRDLSNITILTRNVSEPIAANNASTSTVAFIAQGPPYYPRSHVLYI
GVTYSGESSYRHEVPAVASRSLEDDRFFEVAVTDVTTSTRMLVNNLHRSSFPITYVHGFG
SGKFSYFLTRQRADVKAESHYLSKLVRICQNDSAYYSYTEVPLKCRDSSGKDYNLVQAAF
VGKAGNELSSQLGIQIKDDVLFAVFSPSDPSKGAGSAYPTSESALCVYSLKNIQTKFIHN
IQECFRGNGYRGLDFISTSNKCIATRIRDINEDFCGMDVNTPLGGEQAIEVVALLTFPVR
LTAVAITSTETYTVVYLGTTNGHLKKVVVGDQNSALEYGDITVDEGSPVRQDMFFDKEGD
HLYVVTSNKISKVKAQECSIYKGCEQCLGARDPYCGWCSLENKCSLRRDCRDATQDPQHW
VSYKTGRCTTIAKVSPDKLQRTTARTLNLIIENLPSVEGPLECVFRAMNKVLTTPAKRTA
QGVQCTTPRNDMLPDIPQNQHHFTADLWVRKEEGPEFVSTNFTFFDCNTYSSCTECVSSD
FPCDWCVDGHRCTHDSAENCRNDVLVNGVKRVGPSIRSGPTFCPRITVVESEEILVSSGT
EKSIKVKVDNIAQFITQTRFVCQFNIEGRVTSVTAKLLSDTIYCDKMEFVYTTPSPSTNA
SFAVIWGGSKPLDNPDDIHVLVYQCQLMADNCGQCLSLSERYQCGWCQSTGRCMVSDKCS
GGSAWLQRDKTCPNINVTSFYPETGPWEGDTNVTIHGINLGKHFNDIYDGITIAGIQCQP
FQETYVPTEQVTCRVDSPGIDEYKEGPVVVMVAKEFRGESAGKYKFVNPKITSVTPTSGP
LSGGTVIYISGEHMNAGSNITASIAGLPCHIITSNSTVAWCRTSASHKRHQGSVVMRFDK
GVRELAGQRFTYVDDPVITSVRSGRAGQAAGMRNGPRGIPNGGIIITVDGRGFDVIAEPK
MYVEYDDVEFNSPCFVKNDTRMECRTPEILIPPERERELDPTNGMNLMYGFIMDNVTSVR
NLPQNNHNSLQYFSLFPDPEYYAFGEDDDTVKEYKSDYLTINGANLDRASQELDVEVRIG
DEFCNVTSLSRSQLTCRPPEEQPSPAPGDKSDTGLPLVVVKIGNKLEYRIGRLQYSGLSE
VGAFNQQLIIGLSVGAVVLIIILIVCLIVYRQKSNQNSRVLKNMQEQMDVLELRVAAECK
EAFAELQTEMTDLTSDLIGAGGIPFLDYRFYTMKILFPNMDETSVLQMERPDLDRKEKGL
KIFNQLILNKTFLLLFIRTLEANRYFSMRDRVNVASLIMVALQGKMEYCSDILKTLLAEL
IERCIDGKIHPKLLFRRTESVAEKMLSSWFTFLLYKFLKECAGEPLYMLFRAIKQQVDKG
PVDAVFSEARYSLSEEKLIRQSIEYKEMTVEVSMCQIYLGGGGDGTVEGGETPVKVLDCD
TISQVKEKALDAIYRYYPYSHRPWRDELDLEWRTGTSGRLILYDEDSTTRAESGWKRLNT
LSHYNVPDMAQLTLIPKQSSLYNYMSMLSDKSDKSHHQNQHHNHQSQQHQKYETLNLSKF
SSASPPLSRATSPLNHDNDAGVKVWHLVRQQETEQREGEQRSNKMVSEIYLTRLLSTKLT
LQKFVDDLFETIFSIAHRGSALPLAIKYMFDFLDDQALQHGITDPEVVHTWKSNSLPLRF
WVNLIKNPNFVFDIHKSNIVDACLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPIY
KEWVDRYYSDIKMMQPISDQDMNAMLAEESRMHASEFNTMAALAELYGYAFKYNDQLILA
LEEDEFSTKQRLAYKLEQIHNIMSND
Download sequence
Identical sequences XP_018019925.1.64131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]