SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018028132.1.64131 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018028132.1.64131
Domain Number 1 Region: 441-652
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.76e-54
Family DBL homology domain (DH-domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 127-205
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000589
Family DNA ligase 0.099
Further Details:      
 
Domain Number 3 Region: 225-311
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000000288
Family DNA ligase 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018028132.1.64131
Sequence length 814
Comment PREDICTED: protein ECT2-like [Hyalella azteca]; AA=GCF_000764305.1; RF=representative genome; TAX=294128; STAX=294128; NAME=Hyalella azteca; AL=Scaffold; RT=Major
Sequence
MDSSKQPSLAHFSTDDTMVSHLSNTTTLTTTSNRADLRLCLVGQLASDVDTLQAAQKFHL
PVVTSENGLEYAADQSHCTYFVVADFESPEYAALHEVTSRILGKPALLDMAITQDGVTPS
LVLHTRPVYCHVMRSCIVVFTGFKRKNDVARLLRLIHMMGGSIKNEMGERVTHLIAVCST
GDKYQYAVTFGIPVVTQKWVDTAWAHRDDIGARAANTDMEKEFYLGVFHNLRVVLVGFNE
EDQQTMQRMLDQNSGTVTELKDKSATHVVLEDQRVKEKPPDCPPKAHVVKAEWFWASIQI
NACANESLYTFEVPVGERGPGGVTSPRNSTTTPASGMGGGGGAAAAGGERGGLFSPATPR
SRSRRRKRLRETMQQLASDDSPCAPGSQLQLPASKRRSSVADLISYVSGDGSLLDDSHHT
PAGQNVSAMKTPLSPPSTDLKHLTPRQRVFHELVKTECNYVAILDTINKVIKEPLEDDSQ
PGGPLLDSQELRYIFGHLPPIHDVHTKMRNDFLHLAHNWHPDASIGQIILNYSDDLEKAY
PPFVNYFENVKEMLEKICHERPRFHAFLKIAQSKPECSRQSFQELLIRPVQRLPSMSLLL
NDMLKHTDRNHNDHTALSNALDKIKSVMTFINDNKRKTEAKLKLFEIHNDIEYCPPNLVA
SHRTYVSRADATELSDTCSGRGDSLTLFVFNDVLEENFLVPMDPHHLDIESSDVGFATSL
SKALRFAARTGRKVSRAFSFNKSPGGKLKRAVSTVMSPFATLPNPAMRAAASVTNLAQDL
SLTGTPPPPNSSTMGGMNAMVTPTSRRRLPLKNL
Download sequence
Identical sequences XP_018028132.1.64131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]