SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018087468.1.7800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018087468.1.7800
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily DEATH domain 1.53e-22
Family Caspase recruitment domain, CARD 0.000095
Further Details:      
 
Domain Number 2 Region: 112-188
Classification Level Classification E-value
Superfamily DEATH domain 5.1e-18
Family DEATH domain, DD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018087468.1.7800
Sequence length 197
Comment PREDICTED: CASP2 and RIPK1 domain containing adaptor with death, gene 2 S homeolog isoform X1 [Xenopus laevis]; AA=GCF_001663975.1; RF=representative genome; TAX=8355; STAX=8355; NAME=Xenopus laevis; strain=J; AL=Chromosome; RT=Major
Sequence
MDPKHKELLRRQRLELCAEGLADGLVPQYLLQEGIITESHLEEISSQVTSQRRAMKLLDI
LPTRGPKAFEVFVDSLSEFPWVRENLIKLSKDGTDIPGGRMLELPCKFHHSCPTEKQLNI
LAGKLGPEWEQILVHLGLDHSDLYRCKEQNRYSVQSQIVEGLVKWKRQMGSKATMLQLWQ
ALEAAEADLSVMQYILQ
Download sequence
Identical sequences Q6GR68
gi|148234700|ref|NP_001085317| gi|49257194|gb|AAH71061| NP_001085317.1.7800 XP_018087468.1.7800 XP_018087469.1.7800 XP_018087470.1.7800 XP_018087472.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]