SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018089453.1.7800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_018089453.1.7800
Domain Number - Region: 491-523
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0497
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018089453.1.7800
Sequence length 1139
Comment PREDICTED: transient receptor potential cation channel, subfamily M, member 8 L homeolog isoform X1 [Xenopus laevis]; AA=GCF_001663975.1; RF=representative genome; TAX=8355; STAX=8355; NAME=Xenopus laevis; strain=J; AL=Chromosome; RT=Major
Sequence
MTVRPSTGGSSREFVLHTESRSNSNSRSHSRERPRQRLVDVSSDLIKMRSRRSERLESSR
TLYSSFSRSIELSLDEIDAGKFIQENFKKRECVTYTKDPRSPEGVCKCGYSRSQHTEGIQ
SNQNEKWNYKKNTKDLPTDAYGDIQFETFGRRGKYIRLSRETTPEILYELMTKYWQLKTP
NLIISVTGGAKNFSLKPRMRKIFSRLIYIAQTKGAWIFTGGTHYGLMKYIGEVVRDNTIS
QSSEEKVIAIGITAWGMISNRESLIRSSNNEGNYVAQYVMDEQKRDPLYCLDNNHTHLIL
VDNGTHGQPTTEAELRASLEKYISELNVPDSNYGGKVPIVCFAQGGGKETLKAINTAIKS
KIPCVVVEGSGQTADVIASLVEAEGTTLASSVIKERLLRFLPRTVSRLAEDEMESWIRWV
KEIMENLHLLTVIKIDQAGDEIVSSAISFALYKAYSTNEQDKDNWNAQLKLLLEWNQLEL
ASEEIFTNDRRWESADLEDAMFAALVKDRPKFVRLLLENGLNLRKFLTSEILGELFSEHF
STLVFRNLQIAKNSYNDSLLTFVWKMVLNYQRSHKEDRNSRDYSDIQDLSPIIKHPIQVL
FIWAILQNKRHLSKVIWEQTRGCTLAALGASKLLKSLAKVKNDINAAGESEEIANEYETR
AVELFTECYSNDEDLAEMLLVCSCEAWGMSNCLEMAVEAKDQQFIAQPGVQNFLSKQWYG
EISRDTKNWKILFSLFFFPLISCGFISFRKKPSDKKRSHLWKYFDFFTSPFVVFSWTVIF
YIGFLLGFAYVLLMDFQPVPTGLEIAVYVLVFILLCDEIRQMYMSGIKYFTDLWNIMDIL
AILYFIAGIVFRLHRSNSSALYTGRVIFCLDYIIFTVRLIHIFTVSRNLGPKIIMLQRML
IDVFFFLFLFAVWVIAFGVARQGILRLNEHRWEWIFRSVIYEPYLAVFGQYIADVDGTTY
DFDHCTVTGNESKPLCVEMDSDHNPRFPEWITIPLVCVYMLSTNILLVNLLIAMFGYTVG
SVQENNDQVWKFQRYFLVQEYCSRLTIPFPFVIFAYIYMILRKMFSCCCKEQEPEPSHCC
SKKEDNETLAWEAVMKENYLVKLSSQNNNNMETEQRFKLLEGKLSELKGMIKEIRSKIK
Download sequence
Identical sequences C5IJY6
gi|238534447|gb|ACR44147| gi|239049983|ref|NP_001155066| NP_001155066.1.7800 XP_018089453.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]