SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_018096761.1.7800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018096761.1.7800
Domain Number 1 Region: 1670-1727
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000996
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 2 Region: 1571-1623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000018
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 3 Region: 41-92
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000002
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 1543-1582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000255
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 1712-1764
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000089
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 6 Region: 1634-1684
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000148
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 7 Region: 1313-1357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000501
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018096761.1.7800
Sequence length 2056
Comment PREDICTED: uncharacterized protein LOC108704631 [Xenopus laevis]; AA=GCF_001663975.1; RF=representative genome; TAX=8355; STAX=8355; NAME=Xenopus laevis; strain=J; AL=Chromosome; RT=Major
Sequence
MQGKERSATALDGCVTTRQRLSSTTNQEPDVALMSASDTQQYLCIECNETFSSKVQLSSH
RQSHVAKKPFMCSYCGRGFHHQIFLQVHERSHGGGATSDYLTAAKPSATRVISTRSCRTV
APLTSDCVNVQPIPSKPELLLNSLVQFRKGHGSQQSPAPIECVTRLSRSQAQPCAQRKDS
AEKRSSLEFRVSRFSDTTVHLMDAFGNSIELLTEVFSTHTMNGPQQAPATGTHVLSSVDS
TPCEQRTDRTQQEKNDGETLTSTNLQSHMPPQLVPHTDTPTVCPVETDVGKMESNLSPGV
VVCSAAPSITTAETPMHMESGRLTSGDPALPIETLDDPIETLDDPIDDPIETLDDPIDDP
IETLDDSLSKGTEPISVPHVLPYQVSTELDSSLDGITVSSPPTYSQSVLPSKGHDGPGTN
STKQTDSVPGMDSLEETCNFLVPSEQKQKGSLLAEGTSVLQAEDVRVPGTAQAGGLPEYQ
EREAPTDHSEQVGEIDACTVCISALRTDIAITSELDSQSDMGNGDHKNMLGQNTQSGVKG
VSLVPVNIEKLPSHETFIDLKQSLVQDAHHSAATVQGTDSSLGTETTSAKVGVGHRQRQD
LPCERSAQLVDDGSLLKPHLETGAGDASQLETAENAQAPPTKKDDYMLIHQNAAASLFCQ
EPESQGKDDQVSTTYRHGQDLRSPEPDRTTTHAESLNPSIVDHDYSDQRRTLEDSPVEMA
RHYGPGQYDESQIISGIHDVLPIGEEKNNTPIGGHSEQEQHSLDKRPDLQEGILRNVEKY
TESGTAETALIVTREGETGATGVSQSHGIDIMDLALTGVQPERTEGNEDISRWVSPMDAS
SQEKVIMHEIEKGTIPQTDSLAAFIPTEAALNCVGERSLDKSAPPKRKEGNNADVALSAS
VSDEVEQEGSVPCLTCGEHMNGNKSPSHVCSNFSKSSMTVMENKSIEMIPADVKQDLDSA
TEPHSVEPEEPNAKVNKMYNCPKCDKTFRLPVLLAGHMKCHTSHLCITCGSPMPHKYKMK
RLARKCQQCIQNTIVKRQEKRLLFTRYSEEEDMITSGTKFSTDLNEDSDLTLPCAPNTED
VLGADSEIELTQLKRPHVRQRAKSADGSLGMDPNAEHSEVRKKRGRQPTKGNVLPATVPK
VYKCLQCGVSFLQCMFIVKHMKEHFMAQTQPCKCYLIVRQGGKQTLKQCKMCRQHTKSTA
LDASQLTDSASDQNLQTPISSPKKIIKRGRKGDVSFQRAGNKKIPQKRGKYARKSMAPVR
ECHDEPRLEEESQIPPLEGDAELMSTCWEKSFGEESVPGRGTDKRSEDLLLQPHVCDVCG
KAFRLHRYLQLHIVTHTGTPCESCGCLFRFKRRAGRHSKKCRLCRMKGKEQGVLCDAILE
LSPPELPKAHKAKVLSSLPHGKQSKMLAKFKAPKQAKLNKAFKEKKLQLLKGPPGQSKKR
KLSSVQLEKSRKKLKSIEVLSPPTPKKRGRPPRKQSADSMLSTVNSLAIKSEGKSVVVSD
DGLHPIETTKSSLSGDDKSDEVPTYKNLPTMSIKEEPNASEISSFQCSECGQNFPYKHLL
DNHIQTHTGDRPYACSDCDKSFAKINHLTIHRRVHTGVRPHVCSVCQSSFRQKSSLLAHR
YTHTNQPPLLVTSYECSVCLKEFKQSSDLEAHECILPVELPVQCKECERVFTNKGRLAVH
SRVHTVQTSYPCPICNRSFIYKANLDRHQQKHKGEKPFSCAKCGVSFARRKTLERHKLAH
GKKGLFSCIHCKKYFLLQTWLFRHLKICQGVNKGKVLKVQKRKRIKEDVEVSSTVSSEEV
EKKMIKVENKEQKIKKLMKSKVLGEAKLKSKAAEGSKEEKLKAKAAKAEKGALKKKLTEG
GQGEASSEASSVEEEKKRPNEDNGKKDKKQEQIKGQREFPEGANGDAQPKVKGAAPAEKG
LLNEEKQKAKSAKKDMLGEEKQKAKSATTAKRESDGEEKQNVRVAAPTNKELLGEEKPIG
KGATTTKKESEEEKQKARNFIPAKKELIVDEKQKTKCTPPAKKPRLESSPKVATPERMRK
EGGKGKEPQGKLQSKK
Download sequence
Identical sequences XP_018096761.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]