SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018098992.1.7800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018098992.1.7800
Domain Number 1 Region: 948-1017
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.83e-19
Family TB module/8-cys domain 0.00075
Further Details:      
 
Domain Number 2 Region: 2330-2402
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.35e-18
Family TB module/8-cys domain 0.00048
Further Details:      
 
Domain Number 3 Region: 2049-2119
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.14e-18
Family TB module/8-cys domain 0.0000985
Further Details:      
 
Domain Number 4 Region: 1026-1160
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.61e-18
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 5 Region: 1846-1972
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.46e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 6 Region: 2127-2260
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-17
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 7 Region: 712-854
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.45e-17
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 8 Region: 447-574
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.77e-17
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 9 Region: 534-658
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.92e-17
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number 10 Region: 2448-2576
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.38e-16
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 11 Region: 1685-1748
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.09e-16
Family TB module/8-cys domain 0.00064
Further Details:      
 
Domain Number 12 Region: 1525-1598
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.22e-16
Family TB module/8-cys domain 0.0000709
Further Details:      
 
Domain Number 13 Region: 328-395
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.01e-16
Family TB module/8-cys domain 0.0018
Further Details:      
 
Domain Number 14 Region: 845-929
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.05e-16
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 15 Region: 650-722
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.19e-16
Family TB module/8-cys domain 0.001
Further Details:      
 
Domain Number 16 Region: 182-267
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.58e-16
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 17 Region: 1402-1535
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000173
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 18 Region: 1157-1280
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000612
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 19 Region: 1238-1375
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000322
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 20 Region: 223-339
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000235
Family Growth factor receptor domain 0.0076
Further Details:      
 
Domain Number 21 Region: 2573-2690
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000879
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number 22 Region: 2010-2062
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000356
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 23 Region: 1604-1659
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000963
Family EGF-type module 0.00053
Further Details:      
 
Domain Number 24 Region: 2408-2453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000272
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 25 Region: 2287-2335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000968
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 26 Region: 1965-2009
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000061
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 27 Region: 1763-1818
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000795
Family EGF-type module 0.003
Further Details:      
 
Domain Number 28 Region: 1367-1406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family EGF-type module 0.02
Further Details:      
 
Domain Number 29 Region: 1806-1844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000267
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 30 Region: 2246-2288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000545
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018098992.1.7800
Sequence length 2867
Comment PREDICTED: fibrillin-2-like [Xenopus laevis]; AA=GCF_001663975.1; RF=representative genome; TAX=8355; STAX=8355; NAME=Xenopus laevis; strain=J; AL=Chromosome; RT=Major
Sequence
MALIWLAKFMLGYTALWYVEQAQGQLEQGDLQVDRFAGQEDKLIPQRVRRRGQDTLRGPN
VCGSRFHSYCCPGWKTLPGGNQCIVPICRNSCGDGFCSRPNMCTCSNGQLSTTCGAGIVI
NCNVRCMNGGSCNEESCICQKGYTGTHCGQPICENGCQNGGRCIGPNRCACVYGFTGPQC
ERDYRTGPCFTQISNQMCQGQLSGIVCTKTLCCATIGRAWGHPCEMCPSQPHPCRRGFIP
NIRTGACQDVDECQAIPGLCQGGNCINTVGSYECKCPAGHKQSETSQKCEDIDECSTIPN
VCDGGECTNTAGSYVCVCPRGFTTSRDGSRCIDQRVGSCFSALIGGRCAGELPGQFTKAH
CCCESGRCWAIGQIPEMCPVRGSDAFRRLCFEGLPLGPGFGPEVGPGDMRPGETGGNGLR
PVRPGPGGPNGPEVLPGLSIGIGTATLNQTGDICKLFTNLCQNGRCIPTPASYRCECNMG
YKQDSRLECIDVDECSSSPCVHGDCVNTPGSYHCRCHEGYQSNPTKQACIDIDECIMNGV
MCRNGRCVNTEGSFQCICNAGFETTPDGKNCVDHDECATTNMCLNGMCINEDGSFKCICK
PGFVLAPNGRYCVDVDECQTPGICMNGRCINTEGSFRCECLGGLTIGIDGRVCVDTHMRS
TCYGVIKKGTCASPFPGAVTKSECCCASPDHGFGEPCQPCPAKNSAEFQALCSSGIGITA
DGRDINECALNSEICPNGICENLRGSYRCICNLGYESDASGKNCVDVDECAVNRLLCDNG
LCRNTPGSYTCTCPKGYVFKLESETCEDINECASNPCVNGVCRNNAGSFVCECSFGSKLD
PTGTICVDSMKGTCWLNIQDGRCEVNINGATLKSECCATLGAAWGSPCERCEIDPACPRG
YSRKKGVACEDVNECEVFPGVCPNGRCVNTAGSFKCECPEGLTLDGSGRNCVDVRVEQCY
MKWDEDECTGQLPGKYRMDMCCCSVGGAWGIDCEECPKLGSDEYKTLCPRGPGFANRGDV
LSGRPFYKDVNECKVFSSLCIHGTCRNSIGSFRCICDSGFALDAEERNCTDIDECRISPD
LCGHGTCVNTPGSFDCECFDGYESGFMMMKNCMDIDECERDPLLCRGGTCINTDGSFECI
CPPGHELTSEGNSCVDINECSLSDNLCRNGRCVNMIGTYQCSCDSGFQSTPDRQGCVDID
ECTIMNGGCDTHCTNSEGSYECSCSEGYALMPDQRSCADIDECEDNPDICDGGQCTNIPG
EYRCLCFDGFMASLDMKTCIGVXXXXXXPNICLHGDCENTKGSFICHCQLGYFVKKGTTG
CTDIDECEVGAHNCDVHASCLNVPGSFKCQCQTGWVGDGLNCVDLDECTTEDHKCNVNAN
CVNTPGSYRCACNEGFNGDGFTCSDVDECADNVNLCENGHCLNAPGGYRCECEMGFTPTE
DSKACQDIDECTFQNICVFGTCQNLPGMFRCICDDGYELDRSGGNCTDVNECADPVNCIN
GLCVNTPGSYLCNCPQDFELNPTGVGCVDTRVGNCFLETQPRGDGGLSCSAEIGVGVTRA
SCCCSLGRAWGNPCEFCPFANSTEYKTLCPGGEGFRPNPITVILEDIDECQELPGLCQGG
NCVNTFGSFQCECPAGYYLNEETRICEDIDECSAHIGICGPGTCYNTLGNYTCVCPPEYM
QVNGGNNCMDMRKSVCYRNYNDTCENELSSNMTKKMCCCSYNIGKAWNKPCEPCPLPATP
EYIFLCGNQAPGFIIDIRTGKPMDIDECSEIPAICSNGVCINQIGSFRCECPMGFSYNNI
LLICEDIDECSSGENLCQRNADCINIPGSYRCECSSGYKLSPSGACVGRNECQEIPNVCS
HGTCMDTEGSYICVCHNGFKASGDQTMCMDIDECDRQPCGNGTCKNTVGSYNCLCFPGFE
LTHNNDCMDIDECFSLVGQVCRNGQCINNVGSFQCLCQEGYEITPDGKNCMDINECTSLP
GTCSPGTCQNLEGSFRCICPPGFEVQNDNCIDINECDEEPNICLFGTCTNTPGSFQCVCP
PGFVLSDNGRRCFDTRQSFCFTRFDNGKCSVPKAFNTTKARCCCSKMPGEGWGDPCELCP
QEGSVAFQELCPYGHGSIPGMGDTREDVNECSESPGICVNGICINTDGSFRCECPFGYNL
DYTGVNCVDTDECSIGNPCGNGTCSNVVGGFECACDEGFEPGPMMTCEDINECTNPLLCA
FRCVNTYGSYECTCPSGYTLREDRRMCKDLDECSEGLHDCESRGMMCKNLIGTFMCICPP
GMQRRQDGEGCMDENECRTKPGICANGRCVNTIGSYKCDCNEGFQVSSSGTECADTRKGF
CFTEVLQIMCQLSSTNRNMVTKSECCCNSGRGWGNQCEICPLPGTGAYKKMCPHGPGFTT
DGRDIDECKVLPNVCKNGQCINTIGSFRCHCKLGYTTDLTGTTCVDLDECAQSPKPCNFI
CKNTEGSYQCSCPRGYILQEDGKTCKDLDECSTKQHNCQFLCVNTIGSFTCKCPPGFIQH
QSSCIDNNECNAQPNLCGSRGICQNNPGSFTCECQKGFSLDSSGSNCEDVDECDGNHRCQ
HGCQNVLGGFRCGCPQGYVQHYQWNQCVDENECASQSTCGSASCYNTLGSFKCVCPSGFD
FDQSFGGCQDVDECSSGGGNPCSYGCSNTDGGYLCGCPGGYFRAGQGHCVSGMGFGKGSY
LQAPLEEDEENVLSPETCYECKINGYPKRGRQRRNADDINGNEIQNVSLASVDIDAPLNL
TLNISDLANKQHILEFIPALESLENRVRYIISHGNEGGIFRIHQKDGISYLHLGHKKVSM
GIYNLEIASIPLYRKKELQKLEDEKDHNYLSGEVGQTLKMKLHIHLY
Download sequence
Identical sequences XP_018098992.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]