SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018267572.1.32311 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_018267572.1.32311
Domain Number - Region: 915-961
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.093
Family Ubiquitin-related 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018267572.1.32311
Sequence length 1145
Comment hypothetical protein RHOBADRAFT_56562 [Rhodotorula graminis WP1]; AA=GCF_001329695.1; RF=representative genome; TAX=578459; STAX=29898; NAME=Rhodotorula graminis WP1; strain=WP1; AL=Scaffold; RT=Major
Sequence
MSVLTDPDFLLHALQLSYLRHVLPNHASLSATTTSTSIAVGGGTAAYNLVDFASPDDLAA
NNPYIALSGTADPQRWPELGSRPPSGRRSPPLAPQLARDAAPRRGERAGGGLQYSQTIGM
GAASAGMKVEGGRPRTWKGRGRLSRAGDDVDGSSSRPSSPPDGLAPPPVVIHSPTKTPRQ
TPAIRAADPSSAVDLAPVPSTSSLADRARLASRRSLSSSISTGGVGASAPPSPGDEPPRP
LPSARDRRSSQSLFNSSSTSTPVPSRRRRTSRASSSGSADSDFPDGPAPSRAGPPPPRQE
VPVFQLPPGLRVRERRRVNVRPGDVLAPGAAAPVAPRPPSPSSSVDSDFGVRVPAPAAAA
PVERVPEPPTFQLPAGMRVRERRRVNIRPGQALAAAETTSPRPPPPAPAPAPPPAAPDSL
STSPDSDFADRMPAPTRAQDKPAAPPAFQLPPGLRVRERRRVNIPPGGVVLAPPQPQPQP
PSPEREPEPVSRPATRRRQTSNASSSFASDFGGGLPTPPTPATPAPVLAPLARMDSAPPP
LRSPSSAQVRGDEPPAPEQPQQPAAFQLPPGLKVRERRRVDIRPGAVLATAAAPDSPSSP
APTSPAPALAPSQPSPAPSPAPVALRAPPSRRRSSRPASPSLSGPYFPPRSTYLLPTFSR
VPAATAPPQRSALSALLAAQDAAAGSSARGGLANPFSTLYAACVARSGGAGAGAGAGGPE
GDALRLRLFFPRQGEDEPVEVSVKRDVSVEEVIGVGLWAYWEEGREPGLESEVREDEARE
GRETARWDLRIVEDGEVDEDFPALERTRAISAFAFTEFAIVRADDEQVDDNLAKQATIFR
RPSRILASAPPSAVAPPTTTNAPTAAPDGARPFDPQTCAAASALAVPVLLKIALPPLTAA
EGLVALSNGEEVGVQTTVQVPSDMYLADVLELILRKRGIRSPARDWALVVRLQDGDLVIP
LDRTVESLGEQRELELVLRAQVGPGGVRKSAAAGGGNQDPSQSIFSPSHLIADNAVQPAY
KSTAAAAAASAAPYLHFNVLRKLPMSLGGRHARVVAVDGDYLHFMPPEANLPALTRGRTT
SFHVSAVRDCKVSRRSATAFKIVVHTKRGVDKRYDFEAESAEQAREIVAVVRRVMEFYRN
ERRAR
Download sequence
Identical sequences A0A0P9GVP2
jgi|Rhoba1_1|56562|estExt_Genemark1.C_210029 XP_018267572.1.32311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]