SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018268746.1.32311 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018268746.1.32311
Domain Number 1 Region: 238-325
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000291
Family UAS domain 0.043
Further Details:      
 
Domain Number 2 Region: 427-512,539-551
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000594
Family UBX domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018268746.1.32311
Sequence length 623
Comment hypothetical protein RHOBADRAFT_55776 [Rhodotorula graminis WP1]; AA=GCF_001329695.1; RF=representative genome; TAX=578459; STAX=29898; NAME=Rhodotorula graminis WP1; strain=WP1; AL=Scaffold; RT=Major
Sequence
MDQPLSSTQRAALEQLSAVTARSPDLGSDEARSSLELLRTSGWDVQTAVSRIYDGEGAPS
PNSSSAAAGARHAYPPTPDDDEPDVDDALLAGARNGSARRRGSGGTGGLGTGAVGLYYLR
QALAVPLTILSFPAALIYNLGALLLGLVARLFRLRGPSTTTLRPRNPFGHRAPRTILSPA
AAAEQWVKSIEEATGLSRQVDDAGSSTSGMQATSSSSTGLSARRRGSGLAPPGSGQRIPR
FLVGSYDAALRAARDDKRVLMVVLSSGENERDARFKRDVLCDEEVNRVLEEEDVLVWGGD
VGEREAFQVGQTLSYIALPFVAFVALQPSTPHSSNPATASTASPRLRLLTRLEHSPSAPL
TAASLHTHLVTLVLPRAEPYLARLRAQEVQRAADRLARDEAERRVNELARRDEEKVLAVR
RREEERRRAEREAHERAERAQVELRERERVAGLARRWRAWKRVELAGRPEGADVRVAVRL
GDGRRAMRGFSAEDGTDEVYGWVECELGAADDAAQARADGESEIERRAPPEGWQQQFHFR
LATTFPRQVIALAPHLAAPSSAASAAAAAATGERVTVGEAFQGLGKTVNLVVDGLEERRR
ASMSSREGNDSEDEEDEEEVESD
Download sequence
Identical sequences A0A0P9FAQ1
XP_018268746.1.32311 jgi|Rhoba1_1|55776|estExt_Genemark1.C_140212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]