SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018268923.1.32311 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018268923.1.32311
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.73e-19
Family Ubiquitin-related 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018268923.1.32311
Sequence length 60
Comment hypothetical protein RHOBADRAFT_9880, partial [Rhodotorula graminis WP1]; AA=GCF_001329695.1; RF=representative genome; TAX=578459; STAX=29898; NAME=Rhodotorula graminis WP1; strain=WP1; AL=Scaffold; RT=Major
Sequence
VQSSDTVDHIKEMLVYAVNRSADQQRLIFDGKQLEDGRTLSDYNIQPYATLQLVFRAVGG
Download sequence
Identical sequences A0A0P9F070
XP_018268923.1.32311 jgi|Rhoba1_1|9880|gw1.13.293.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]