SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018272564.1.32311 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018272564.1.32311
Domain Number 1 Region: 99-183
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000508
Family SH3-domain 0.0023
Further Details:      
 
Domain Number 2 Region: 967-1044
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000167
Family Ras-binding domain, RBD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018272564.1.32311
Sequence length 1864
Comment hypothetical protein RHOBADRAFT_42858, partial [Rhodotorula graminis WP1]; AA=GCF_001329695.1; RF=representative genome; TAX=578459; STAX=29898; NAME=Rhodotorula graminis WP1; strain=WP1; AL=Scaffold; RT=Major
Sequence
HYVHEDEHHAQAGYGPDDDSGLYSDDEVAQALQGHTGQGRFQYHHHDDPDYAPDDDDQQH
PDHDQVEGNPDDNDLDDTASFSDSLSSSPSIPDDDIDFNLVYALHTFLATVDGQASVVKG
DKLLLLDDSNSYWWLVRVLKTQAIGYIPAENIETPWERLARLNKHRNVDLTSATQADVLS
GPTSTAAQTRFVGRIPPWQQPHPHESRHPYSKGVPASPSHKDHPRNISPSGLERPASSKA
KTVLFAAPTYYAHSASGMTSEGEDDEGESVGVGGDEGDLLEEEEGDDEHGEVEGLGIDER
DLGPERDGDDDDEVDAEGRRRRYSRPEDGGDEGGFDEDDEDERMHDGSDTDDRARDEYGR
PVAARSSSSSASASHPHALTPASAPAPASARLADTDADADDLSPESRRGHSPYALDAGAV
PPEAAEHWERERDAALHAQHEAAAAEARWARGGSAQGQAHEPRSPSRGPLTVQDLAPPVS
HVPADLELGMSLSPTQLAPQPHAQRVASPPTTTRSPLSSSASPPLSSSTASASASALDDG
LFVDPAAPTKKLSATPRIARNSTTSALSAGSAAEFDEMLGLGINGGEQQQQQQQRASTAS
PYAGPVSSSSAPRPGSLARPSPGPGPGAGGPPPQRVRGVDLVDPRDPRYDRMLQPTKQAG
EDLVYERMVAQQQLRVGPAAAGGPPQRAQGRPSSGLYASGDEGDEAQLGASAGSSNVGGE
GDKRASTSADKKRKSGGGIMSLFRKKDKKKKGDEGAVAAGAGGGGGAAAGLRSSEDSAQG
GSSSPTRGAFRRSSSSSSPSLGASEPRSSADRGGSSSGHGGPPSSSRAQGPPGAATAESM
FSTDAALRQQELEARQALFHQYGVQRSPGDVSNTMTPRGAPGVLVVNDEYQGPSGTSVGG
PGGSKRNSIQLLNYPGALSSSSVGPNGAAGSPSASSLAPPQRMRPGSLIGSPNMAGAGGL
EVPVLSVMRVFTGAHIDSEATFKTVLLNATTTAADLVKQAMQRFRLTGSDVTRDDFYLTV
KELGGDERALRDDEHPLRVFEDLSDRSAEGDEAGGFQLPPSVKRSSIGSINSISSNLSMH
PAIASSGVNDWSDDSAVKFYLHRRGGPSSPLVGSQPGDQGGPADASFANPSSLDHHDSTA
SSSDVTATQQQSFLGSSTSSMATTAPSYRFAVRVLIHPSDLPETVVFDPSSTAIIPRAVL
AERQSRAGGFADPSPALMTLPPREKVIFFPRNANVSEVIETALDRFGIVDGVVDGGDEVE
DRVNRRRSQARVKYGLAVQRDGQESFLNASSKLLDAYSTAPLFKAYDRSSREFRRRSADA
TLILGTSSDVQPHDPTFVIRRSPVRPGATNRGAALPQTIDELEKVQQRRAAAAQHAEDVG
SDDEQEVLEDSSPNPEAARGKSQRDLIAAQRAAQRANQSALLSARGNDGHGFDITVPQEG
TIRSSRADEGDEVRYSFVHQDGTETDISEIVEDEWHGGATPTRASSSPAPPPPAASSSSS
SMQRPTQGMSRGASAATTTDAESFVTATGSLAPMSDDEDDDERRAVDALRSTSVDVERAG
SPRDRLPRSLALNGSATSASYHDDHLRSALGPRPMTSPVMEGPLQERLDRVLARVKEEKA
RRAASPSGSFGWRPRSYISNGGSATASGRTSPAASTSARSASALSGRRSPFGDVLRDSPS
IDQLMSSSSLHSPRTGASGPGSGVGAGSGSASSPRQRARAGSGSTPYEGHAKRASVISMS
SAGSTAATTDQLSTPLTAGSSSQHFTPASSANSNHRAPSQPSYRDDYGYETLAAIVSAAA
AARPAVGGARASSTRDSIDERLFGRELDVDNLHPEVRRAYEVPAKTFGDLDERLDALMRE
LVSV
Download sequence
Identical sequences A0A194S7P7
jgi|Rhoba1_1|42858|gm1.2423_g XP_018272564.1.32311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]