SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018273751.1.32311 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018273751.1.32311
Domain Number 1 Region: 314-402
Classification Level Classification E-value
Superfamily BAG domain 0.000000000000011
Family BAG domain 0.0028
Further Details:      
 
Domain Number 2 Region: 140-203
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000159
Family Ubiquitin-related 0.0032
Further Details:      
 
Weak hits

Sequence:  XP_018273751.1.32311
Domain Number - Region: 30-103
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 0.0133
Family beta-Lactamase/D-ala carboxypeptidase 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018273751.1.32311
Sequence length 411
Comment hypothetical protein RHOBADRAFT_41698 [Rhodotorula graminis WP1]; AA=GCF_001329695.1; RF=representative genome; TAX=578459; STAX=29898; NAME=Rhodotorula graminis WP1; strain=WP1; AL=Scaffold; RT=Major
Sequence
MQSANNALTSAVDRALPPLHHALAASRSHALDLYQALHDSDNPAAQALVRALDHPRVQAT
YARATTLASDQAPLLISVLGLAVHLYFANRTTRRAQAQLEHQFQQRNGSAMSDYGLGDPA
GATAAAGATRSQRSRDDHGLVEVQWGREKIRVPLPPPSSPLSTLRASLYNLTGVPPSHQK
LIYSGAVLKDDLAPLSAYGLTDDEPASSSSAADDGDSSAKKSFWDSWSFAGRSSSSRSGR
KLKKLVMLGSKDVSARVDDRLAQRKDLADLAAADAAAAGAAAGGEGAVAGGAGGKEPESE
DALRARIRDVAGQKLDELEPQVRQVEEWLEQAQAQAASGDETAEAPSAPSRTLIFLSEVL
LQGLLKLDAFEIPSAYADARKERKDAVRRVQDTLDRVDRAKEGWKKVGAKP
Download sequence
Identical sequences A0A194SAR4
XP_018273751.1.32311 jgi|Rhoba1_1|41698|gm1.1263_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]