SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018274677.1.32311 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018274677.1.32311
Domain Number 1 Region: 1277-1393
Classification Level Classification E-value
Superfamily PH domain-like 0.00000006
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018274677.1.32311
Sequence length 1422
Comment hypothetical protein RHOBADRAFT_51073 [Rhodotorula graminis WP1]; AA=GCF_001329695.1; RF=representative genome; TAX=578459; STAX=29898; NAME=Rhodotorula graminis WP1; strain=WP1; AL=Scaffold; RT=Major
Sequence
MAAPPVAPATPTRDHDPASLRSPIVLSTRSPAAPRPASVLIQNVRGAEGGVEAITARRRN
SGSFKTMSTGGLVSNSPFAKRLGQTSPTKSAASSPTSTLYTSSRIPAPSSSSTSGGASSA
RRTSGSRQSSGEQEQGPVKENSIPSDLNELATAKDDDSKSRSSSPAVPFRPTRQQAPASS
PFKPSRSPIDEPAQPRRQTSSYAHLRSNNLVSSSPFTAQQAAPSPELQQVPYEIGALTLE
SAPMELFYDDSSSAGDRSPHLDVGLGARPGQGVLGPVSRHAAGASAPPPVSPPPPSSTST
SSAMAPVRRGMRGPRPLSGDAADDLAEEQGRVVRRQPSSKSVAWAETEEVFEFEVEEERR
RSMMSDASGLSDEGYYGRRGAGEEDDEDSSFEDDGYGAQHASYSFEEGGSVEVHDVDDGA
SDAEESVVSNTSSAMDEVIGQIDSYLHEESYDAADVFSPSQILDGDHDHGEFADQPDLPT
HHDTSGYSSPAVPQQRGPVSAFSVSTADDGASDVMSTSAYGDDDDQDERDAHFDATRQAI
MGRALGAPVPPVPMSPGRPPLPPRPASATSPATRADPIPGSLLAHSDSQFSLPDIPGTSP
FMGFEDDGTAGSVVSLANNAKPHAAATVPTTRPLSLHSHMAVATSTPVKAARAEPAEETT
PTKSTPSSTATRGLGLAPSSSAGSPILAALHRSPDAATATLVPPGSASPALSRKASLVGS
DVTTSSTSWYVSSVTGSLRGGRIGSGLESTMKRHEAILGSPFMPSSSGAFGAFPKPSTPA
PALSVETASPARSASTMGSTGKSTPPTSHASTAGSSDAAGGGVAPRSLKSARAIEARPAL
KAHGATLSSGMMPTIAASSQRAQLGLSVGSPLTARVAEEMQSPLERLQMGVQGRGEGAEW
RDGDSLLGGAEGDEAGDEVSSLRPGAGAGAGGAVKRLQRRRSRSTGDADLAETTSSVGAQ
HTMPELGFEQQRGGEGGAFGSSVLESLDDIYNSRNRTYRVRESKHLVVVSDIAGHTAGDV
DPGKAWRKKRPSNVHEINRSMSTMSVNSQAVRKNREFAGQLFVLIREASFEGMPLPRTKA
MVTATLDNGRQRVDVAVRELGNKVSLRKEFELACNQDLAFSIDFSVPRQTPVSTPVLPST
PSVPAPTPPASPSKAHRAFRIFSSPKKKAAQAPARPTSTLAAAPPPTPDPFYDYVSSNGQ
LATAHVTFATEAAACRLKKTRVVLPFGAKTVGSPRSCSGSLEIDLLFVPAVQGVPKAHLP
KSMDEVLDGLERADFATKVVHESVLTQLGGDTTVWRRRVVKLRGSTLVPYNEVTKRSHVE
INLAQVVAVEDLNAPSSTSRAAARDDDDDDESVTRMDHSFRLVFEDGNRIDYFADSHAIK
TKWLEVLAAVVGQDGDKKTAPDWAVAVRKLPPPKALALKAAA
Download sequence
Identical sequences A0A194SD15
XP_018274677.1.32311 jgi|Rhoba1_1|51073|estExt_Genemark1.C_1_t20237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]