SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018312675.1.62676 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018312675.1.62676
Domain Number 1 Region: 96-548
Classification Level Classification E-value
Superfamily Sema domain 1.7e-122
Family Sema domain 0.0000672
Further Details:      
 
Domain Number 2 Region: 1435-1559,1815-1999
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.97e-42
Family p120GAP domain-like 0.03
Further Details:      
 
Domain Number 3 Region: 899-989
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000252
Family Other IPT/TIG domains 0.025
Further Details:      
 
Domain Number 4 Region: 1078-1149
Classification Level Classification E-value
Superfamily E set domains 0.000000000000686
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 
Domain Number 5 Region: 550-602
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000327
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 992-1078
Classification Level Classification E-value
Superfamily E set domains 0.00000000126
Family Other IPT/TIG domains 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018312675.1.62676
Sequence length 2035
Comment PREDICTED: plexin-B [Trachymyrmex zeteki]; AA=GCF_001594055.1; RF=representative genome; TAX=64791; STAX=64791; NAME=Trachymyrmex zeteki; AL=Scaffold; RT=Major
Sequence
MRFLGLTQSFPKSPTVTHLQVPLPPLLHRLSFSSMSIATWFLVILATAAIDTPASTVPPI
QDNKSPHIIAQFPAGNGQRYGHFSLDANATREGALRFNHLAIDPSSGRLYGAAINRLFQL
DSNLRLEEYVSTGPRLDNPQCHATGCMARDIPTSLMDNVNKLLIADVKSQMLIACGSLLQ
GACERYKMSNISIKPEFIPLSVAANDENSSTYAFIGPEKYNPWEQTNILYVGTTFTNKGD
YRHDVPAISSRNLDNLEFTEYTFNKQSIVYIDVKYRDHFLVKYVYGFNASDYAYFVLVQK
QSYLPEQEELGYISRLARSCISDPNYDSYTEVTLQCTVDLGDGKQHHYNLVQDAKVAAAG
SDLAMQLGISVGDPVFVSVFSPSRGITNEPLSRSAVCIYSLQDIETKFNENIHMCFNGSI
KYRNMGYVSGPIQDGKCPTAGTTGNILNFCEVGLKISGVSPITGQAILHFPDTFISSVTI
ANTESHTVAFFGTSDGILKKVLLSGVEAFVYESITIDKGQKLLPDTLISPDGESIYVLSN
SKISKVKVEHCNGYTNCSSCLDAKDPYCGWCSLEKRCTVRGDCQKASHSSPRWLSLGTGQ
QCIDFEQVLPDRMPINQMTTVQLTIRTLPELPTGANYKCVFGNAEPIDALMTGFGLSCPT
PPVVERPSIPEGADHVLVPLSVRSSETNKDFVSRNFAFFDCSRHTVCTECVKSQWACSWC
VYDNKCTHNTSCQGIISGENQNQANLAAYGAQYCPRFMERKEPLMLPNSVPKEIVLEVEN
LPHPQVGHSGFQCIVSIEGANLKVQARVDNSRFIVCDKTIYSYEEISGEYEAEVTVVWNT
NHHVDKTTIILYKCEVLGSHREHADCSLCVTRDARFECTWCGNSCVYRHSCLQSPFTECP
KPRIDMIKPLSGPIEGGTLVTIEGSNLGLKESDVEGKIHIGNTPCTLINYEVSVRIVCRT
GRHEATDAASVVVGNDAGYTESAVLFNYKDIRLSGVYPSVGPQSGGTQLAITGKYLNIGS
TISAYLDELPCHVNATQASSTRLTCVTSKSGRVRRIHRLTLSIDGANRTLMDNPYNYTHD
PTIMEIKPLRSFASGGRMITVHGTNLDTIQKPEMEVYFDNEQLPVNRTVCTVLNPTQMEC
PSPSVAKRFVSIRRSERSAATSTLGTSSPHSLRLKESQLSLKIAFIMDYVESVRDLEKQS
LRNRLLYVEDPTFFPFPRNVKLYKGDTLVIEGENLNYASDESDVNVTVGIMPCNVTSLAL
TQLVCTPPDQQPADTDELGIKTESGLPLVVVRVGRSLRFPIGYLRYEVIKSYPIPPEAIA
GIAAGTFGLIFLFVLVLVIYRRKSTQAEREYKRIQIQMDTLESNVRMECKQAFAELQTDM
TDLTADLESSGIPTLDHKNYIMKVFFPGVIDHPILNDPRSRSNISRTNYDAAMIQFEQLV
NNKYFVLTFIETLEAQKDFNIRDKVNVASLLMVVLMGKMEYATDILMNLLLRLIDKAVNT
KHPQLMLRRTESVVEKMLTNWMALCMYNYLKDYAGSSLFLLFKAIKHQIEKGPVDVITHD
ARYSLSEERLLREQIEHTIVTLHVVQDDLDEKIQCKVLDCDTISQVKSKILDALYKNTPF
SLRPSIHDVDLEWRHGRGGHLTLQDEDLTTKCCGEWKKINTLAHYGVKESAVMSLIPRQN
DGFSVACKPPCHNCKPSHYHPQQQQPSIHPHHQPSHHHLHRHSNHCSSTHLPSTPNHGLI
SPVMYNHPVSGLYFDSQHSPPIITANGDVESAHGGNQRLYHLVRPIEDVHYPPGLGFTGS
SKHHHPERTHKAIPEIFLTRLLSTKGTVQKFVDDFLNTILTANEALPSAVKWLFDLLDEA
AKQHGIVDPEVAHAWKSNSLPLRFWVNFIKNPDFMFDINKSTTVDSSLSVIAQTFMDSCS
MTEHRLGKDSPSNKLLFAKDIPHYREKVGRFYTDVQRLPQITDQEMSSAMQQLSASHANE
FDVIAALKELYIYVSKYYEQILEALETDAGCRKLHLAHRLENVAYTLEGEETSAC
Download sequence
Identical sequences XP_018312675.1.62676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]