SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018398972.1.22276 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018398972.1.22276
Domain Number 1 Region: 97-549
Classification Level Classification E-value
Superfamily Sema domain 9.16e-121
Family Sema domain 0.0000845
Further Details:      
 
Domain Number 2 Region: 1437-1561,1826-2010
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.28e-42
Family p120GAP domain-like 0.03
Further Details:      
 
Domain Number 3 Region: 900-990
Classification Level Classification E-value
Superfamily E set domains 0.000000000000021
Family Other IPT/TIG domains 0.022
Further Details:      
 
Domain Number 4 Region: 1079-1150
Classification Level Classification E-value
Superfamily E set domains 0.0000000000007
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 
Domain Number 5 Region: 551-603
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000249
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 993-1079
Classification Level Classification E-value
Superfamily E set domains 0.00000000105
Family Other IPT/TIG domains 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018398972.1.22276
Sequence length 2046
Comment PREDICTED: plexin-B [Cyphomyrmex costatus]; AA=GCF_001594065.1; RF=representative genome; TAX=456900; STAX=456900; NAME=Cyphomyrmex costatus; AL=Scaffold; RT=Major
Sequence
MRFLGLTQPFPKSPTVTPHLQVPLPSVHHRLSLSSMSIATWFLVILVTAAIDTPASTVPP
IQDNKSPHIIAQFPLGNGQRYGHFSLDANATREGALRFNHLAIDPSSGRLYGAAINRLFQ
LDSNLKLEEYVSTGPRLDNPQCHATGCMTRDIPTSLMDNVNKVLISNVQAQTLIACGSLL
QGACEKYKMSNISIKPEFVPHSVAANDESSSTYAFIGPQKYNPWEQMNILYVGTTFTNKG
EYRHDVPAVSSRTLATLQFVEYTFNKQSSVFIDVKYRDHFLVKYVYGFNASDYAYFVLVQ
KQSYLPEQEELGYISRLARSCISDPNYDSYTEVTLQCTVDLGDGKQHHYNLVQDAKVAAA
GSDLAMQLGISVGDPIFVSVFSPGRGITNEPLSRSAVCIYSLQDIETKFNENIHMCFNGS
IKYRNMGYISGPIQDGKCPTAGTTGNILNFCEVGLKISGVSPITGQAILHFSDTFISSVT
IANTESHTVAFFGTNDGVLKKVLLSGVEAFVYESVTIDKGQKLLPDTLISPDGEYIYVLS
NSKISKVKVEHCSGYTNCSSCLDAKDPYCGWCSLEKRCTVRGDCQKASHSSPRWLSLGTG
QQCIDFEQVLPDRMPINQMTTVQLTIRTLPELPTGANYKCVFGNAEPIDALMTGFGLSCP
TPPVVERPSIPEGADHVLVPLSVRSSETNKDFVSRNFAFFDCSRHTVCTECVKSQWACSW
CVYDNKCTHNTSCQGIISGENQNQANLAAHGAQYCPRFMERKEPLMLPNSVPKEIVLEVE
NLPHPQVGHSGFQCIVGIEGANLKVQARVDSSRFIVCDKTVYSYEAVSGEYEAEVTVVWN
TNHHVDKTTIILYKCEVLGSHREHADCSLCVTRDARFECTWCGNSCVYRHSCLQSPFTEC
PKPRIDMIKPLSGPIEGGTLVTIEGSNLGLKESDVEGKIHIGNTPCTLVDYEVSVRIVCR
TGRHEATDAASVVVGNDAGYTESAVLFNYKDIRLSGVYPSVGPQSGGTQLAITGKYLNIG
STISAYLDELPCHVNATQASSTRLTCVTSKSGRVRRIHRLTLSIDGANRTLMDNPYNYTH
DPTIMEIKPLRSFASGGRMITVHGTNLDTIQKPEMEVYFDNEQLPVNRTVCTVLNPTQME
CPSPSVAKRFVSIRRSERSAASTSVLGTSSPHSLRLKESQLSLKIAFIMDNVESVRDLEK
QSLRNRLLYVEDPTFFPFPRNVKLYKGDTLVIEGENLNYASDESDVNVTVGIMPCNVTSL
ALTQLVCTPPDQQPADTDELGIKTESGLPLVVVRVGRSLRFPIGYLRYEVIKSYPIPPEA
IAGIAAGTFGLIFLFVLVLVIYRRKSTQAEREYKRIQIQMDTLESNVRMECKQAFAELQT
DMTDLTADLESSGIPTLDHKNYIMKVFFPGVIDHPILNDPRSRSNISRTNYDAAMIQFEQ
LVNNKYFVLTFIETLEAQKDFNIRDKVNVASLLMVVLMGKMEYATDILMNLLLRLIDKAV
NTKHPQLMLRRTESVVEKMLTNWMALCMYNYLKDYAGSSLFLLFKAIKHQIEKGPVDVIT
HDARYSLSEERLLREQIEHTIVTLHVVQDDLDEKIQCKVLDCDTISQVKSKILDALYKNT
PFSLRPSVHDVDLEWRHGRGGHLTLQDEDLTTKCCGEWKKINTLAHYGVKESAVMSLIPR
QNDGFSVACKPPCHNCKPSHYHPQQQQHQQQQQQQQPSIHSHHQPSHHHLHRHSNHCSST
HLPSTPNHGLISPIMYNHPVSGLYFDSQHSPPIITANGDVESAHGGNQRLYHLVRPIEDV
HYPPGLGFTGSSKHHHPERTHKAIPEIFLTRLLSTKGTVQKFVDDFLNTILTANEALPSA
VKWLFDLLDEAAKQHGIVDPEVAHAWKSNSLPLRFWVNFIKNPDFMFDINKSTTVDSSLS
VIAQTFMDSCSMTEHRLGKDSPSNKLLFAKDIPHYREKVGRFYTDVQRLPQITDQEMSSA
MQQLSASHANEFDVIAALKELYIYVSKYYEQILEALETDAGCRKLHLAHRLENVAYTLEG
EETSAC
Download sequence
Identical sequences XP_018398972.1.22276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]