SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018403761.1.22276 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018403761.1.22276
Domain Number 1 Region: 110-230
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.15e-35
Family cAMP-binding domain 0.00000134
Further Details:      
 
Domain Number 2 Region: 239-361
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.45e-32
Family cAMP-binding domain 0.00000189
Further Details:      
 
Domain Number 3 Region: 10-57
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.96e-20
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018403761.1.22276
Sequence length 372
Comment PREDICTED: cAMP-dependent protein kinase type I regulatory subunit isoform X1 [Cyphomyrmex costatus]; AA=GCF_001594065.1; RF=representative genome; TAX=456900; STAX=456900; NAME=Cyphomyrmex costatus; AL=Scaffold; RT=Major
Sequence
MAANLEEEQSLRECEEYVQRHNIQQVLKDCIVQLCVGRPENPISFLREYFQKLEREQAHD
AKQQIATSPEDTEDMPAGQQGPQVPRRRGGISAEPVSEEDATSYVKKVVPKDYKTMAALS
KAIAKNVLFAHLDENERSDIFDAMFPVTFLPGEAIIRQGDEGDNFYVIDQGEVEIFVNGE
LATTIGEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEF
LSRVSILESLDKWERLTVADALEPVAFDDGETIVRQGEPGEDFYIIVEGTAVVLQQRSEG
DEPAEVGRLGPSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPCADILKRN
ITQYNSFVSLSV
Download sequence
Identical sequences A0A026WQN0 A0A151I9B1 A0A151WK01 A0A158NNW5 A0A195BSW6 A0A195EWA7 E2AEL2 E2C7R5
Cflo_02653--XP_396167.1_APIME Hsal_06200--XP_396167.1_APIME XP_011152204.1.56509 XP_011156589.1.47049 XP_011256816.1.72520 XP_011332412.1.87679 XP_011641418.1.19355 XP_011684295.1.89273 XP_011869495.1.68811 XP_012059223.1.45171 XP_012216834.1.42766 XP_012540211.1.53737 XP_014473655.1.44477 XP_018059121.1.4000 XP_018313810.1.62676 XP_018352269.1.14990 XP_018403761.1.22276 XP_020292926.1.29359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]