SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018415576.1.44173 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018415576.1.44173
Domain Number 1 Region: 14-234
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.6e-38
Family Ankyrin repeat 0.00029
Further Details:      
 
Domain Number 2 Region: 252-294
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000667
Family SOCS box-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018415576.1.44173
Sequence length 440
Comment PREDICTED: ankyrin repeat and SOCS box protein 12-like [Nanorana parkeri]; AA=GCF_000935625.1; RF=representative genome; TAX=125878; STAX=125878; NAME=Nanorana parkeri; AL=Scaffold; RT=Major
Sequence
MLRYRGLEDDHVESRELHLAVSLDDPQHLAKLLSLDRYKNYVDSRSGWGVPMTPLRQAAS
NGSVECLKILLANGAEVDSLDVKAQTPLFAAVSGGHSECVRVLLEAGANPRGSVHNNCTP
VLTAAREGNAQILKELLEYGADANVRAKLANRATPNPGCTGPLYLAAVYGHLECFRSLLL
YGADPNYNCTDLQLLKKMKHPQSVLEICLKHQCHPEFVKLLIDFGADLYLPNVHAMSLSD
SPSLKLIEREKGFPGSLMFQCRVTIRRLLKQMGKLHLIDQLEMPDRIVGYLQHHNSYCQR
QDLEICNQRFYSQPASSLNFPPVSSLPLDPVDGVRSGPWLKCTSIPISSCSFLQACGKVG
IFYGLPVTAVVGGGGQVEAALVQEHQSAEKGRWSPERREQETAEARGLERSAAEIHDAVQ
IHDHQQQSFMALGATQTRSV
Download sequence
Identical sequences XP_018415576.1.44173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]