SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018497001.1.18380 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018497001.1.18380
Domain Number 1 Region: 59-509
Classification Level Classification E-value
Superfamily Sema domain 2.35e-104
Family Sema domain 0.000052
Further Details:      
 
Domain Number 2 Region: 1392-1517,1689-1839
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-41
Family p120GAP domain-like 0.015
Further Details:      
 
Domain Number 3 Region: 862-953
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000318
Family Other IPT/TIG domains 0.03
Further Details:      
 
Domain Number 4 Region: 957-1043
Classification Level Classification E-value
Superfamily E set domains 0.00000000000216
Family Other IPT/TIG domains 0.04
Further Details:      
 
Domain Number 5 Region: 512-546
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000301
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 6 Region: 1041-1112
Classification Level Classification E-value
Superfamily E set domains 0.000000000318
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018497001.1.18380
Sequence length 1909
Comment PREDICTED: plexin-B [Galendromus occidentalis]; AA=GCF_000255335.1; RF=representative genome; TAX=34638; STAX=34638; NAME=Galendromus occidentalis; AL=Scaffold; RT=Major
Sequence
MTSRRWGADTHLKSPWRRRPVDLFIWSALLSIFAVQISAAVQPDTLINEYRLPGNHSVNL
THVIINPQTGHLFAGATNLVMEFNENLTLVRSVATGPEFDNEQCPISNCKATGIELRQIN
TINKVLLIDDENGKLIVCGSTHQGACQRMDLSNIVKKEPLVNYPVATNDENSSTFAMIGP
AKFAVGNQRMLYVATTRTRYGTYGDHRPAISGRSLEGQGDLFGILEQSFSTIARVDLDTS
VKDYYLVNYVYGFHTDDYVYFATVQMRSHLLSLQELGFNSRLARLCAGDPSFNTYTEVSL
ECRGHDGTDYNLLQDATLVEVGSDLARFLGLRDDRRVFVGVFAQSADHTTKPSGKSAVCL
YPLRQIEKMFTENIHMCYNGTVATRNMDYVAGSLADCPAPGKSGNVYSFCNETLKVNGSA
PIRAQAAATWQGVTLTAVVVTITQQHSVAFLGTNHGTVKKILLSADGVGEEFEEVDVDRP
HPIIADMHLSPRGDFIYAASPYKVAKLKVTECEQYDTCSACLQARNPYCGWCSLEKRCAV
KSACHSPSIVEDRLSATRWLSLDSQQCIDFQWIRPEQLAVSATSSIEISINQLPQLPNGA
FYICVFGTDNKVPIQARVTPNGLMCATPSVSSRPRVPANMDSVDTLLAIRSSETKKDFLQ
RPFTFYDCSAHKTCGSCVTSRFACNWCFSDNKCTSDTSSCSKTVILGENNPVDNLMNKGR
AYCPSFEVNNSLLLADGSRSEVTVEVRNLPSPADNFECLIDIEGRQTKVVASVRQNRVIC
AETEYSYREATGEVQAQLTVLWNRDTFIGRTNVTLYKCSLLGSHAGRGDCSLCASRDPKY
ECSWCGNQCSYGPSCSEPVQTTCPPPRIDWIHPLSGPIQGGTLITIEGSNLGTSREEIED
KITVGGVPCRVVDYSVSVKVSCITGPADGAITAEVHVGNRAGLSSAKEKFSYKEITLDEV
NPKMGPQSGGTRLYISGQNLNIGSNVEVYLDNQPCIVDKTLASNSQISCTTTRSEIPYNV
STLTLKIDNSTRLLRYPFIYVNDPKIIDITPKKSFVSGGRRIRVTGSNFDAIIAPKIAVF
SNDNIINETSCEVESSSIMYCSSPPVNSEIFVARPAARRGIESEALLDEWRFKIGFLMDN
VSSVRDLPRNFPELISEMVYVPDPFFYPFDNAGHVKLYKGESLVIEGMNIRHGLREDNEI
SVHIGDERCNITSVANNQLVCLPPTEQPQAYSNYWHGKESRNDLPLVTVRIGPNLLYVIG
YLRYEFSKRGDLPSEAVAAIAAVGILLTVVSLFIIVLLRHKSTQAEREYKRIQLQMDDLE
KSVRIECKQAFAELQTDMTDLTNDLYAMGVPTLDHRAYVMKVFFPGVFDHPLLRDNKLSN
NGYYNNYEVAMTQFHQLLFNKSFLINFINTLENQASFTIRDRVNVASLLMVIFMNKLEYG
TDILRTLLLQLIERSTSSKHPQLMLRRTESVVEKMLTNWLAISMYDYLKDFAGSSLFLLF
SAIKYQVEKGPVDAVTHDARYSLFEARLLREQVDYATVTVHVVQEEQGDKLVCRVNDCDT
ISQVKHKILDALYKNTAHSLRPNVQDVDLEWRHGRGGHLILQDEDLTTKTINGWRRMNTL
RHYGVKDFAIMSLVSKQNDSFNALKSTHGGSHTSSSAHSDVENGLKYWHLIKNDDDKKND
QAYTKAIPEIFLTRLLSTKGTIQKYVDDFFTTILSANEALPPAIKWLFDLLDEASMLHGI
TDPEVPHAWKSNCLPLRFWVNFIKNPDFILDVNKTPVVDSCLSVIAQTLMDSCSLTEHRL
GKDSPSNKLLFAKDIPRYRKKVCDFYHCLAMMPTVTDQDLCVHLQQLSLQYGGEFDANIA
VKELYVYAAKYRDHVLLSLDSDPQCRNMHLAHKLHNVACTMEGQPTSVC
Download sequence
Identical sequences XP_018497001.1.18380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]