SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018520702.1.34915 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018520702.1.34915
Domain Number 1 Region: 169-236
Classification Level Classification E-value
Superfamily Homeodomain-like 3.59e-21
Family Homeodomain 0.0026
Further Details:      
 
Domain Number 2 Region: 58-123
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000527
Family LIM domain 0.023
Further Details:      
 
Domain Number 3 Region: 28-55
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000134
Family LIM domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018520702.1.34915
Sequence length 308
Comment PREDICTED: LIM/homeobox protein Lhx6-like isoform X2 [Lates calcarifer]; AA=GCF_001640805.1; RF=representative genome; TAX=8187; STAX=8187; NAME=Lates calcarifer; AL=Scaffold; RT=Major
Sequence
MSKSEVKKESSESSPSEAACLCSPPAAKNQCASCGMEIHDRYLLKVNNLNWHLGCLECSV
CRASLRQHSSCYVKNKEIYCKLDYFRFGTKCAQCGRQVYASDWVRRARGSVYHLACFACF
SCKRQLSTGEEFGLVEGRVLCRSHYDIMLDNLRRAAENGTGLTLEGALPSDQDCQPKPAK
RARTSFTAEQLQVMQTQFAQDNNPDAQTLQKLAEMTGLSRRVIQVWFQNCRARHKKQPPQ
SSFSQSAPLSRMPPSLPDDIHYSPFSSPDRPHLLALHGYLDTHPFSVLAAPGHLTHPSIS
LPQLPISR
Download sequence
Identical sequences XP_018520702.1.34915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]