SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018539266.1.34915 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018539266.1.34915
Domain Number 1 Region: 4-138
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 6.02e-31
Family Rap30/74 interaction domains 0.0000039
Further Details:      
 
Domain Number 2 Region: 195-262
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.26e-25
Family DNA-binding domain from rap30 0.0000427
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018539266.1.34915
Sequence length 270
Comment PREDICTED: general transcription factor IIF subunit 2-like isoform X1 [Lates calcarifer]; AA=GCF_001640805.1; RF=representative genome; TAX=8187; STAX=8187; NAME=Lates calcarifer; AL=Scaffold; RT=Major
Sequence
MSEKGEVDLTGAKQNTGVWLVKVPKYLSQQWAKATGRGEVGKLRICKKGNQGKAEVSFTL
NEELTVIEGIEDKTVSAPREHPFTMQSVGGQMLAVFTETSSGQSEERSDGSSSGSGAGAG
PDKIALEGVVVQRAECRPAVNENYMRLKRLQIEESSKPARLSQQLDKAVTNNYKPVANHA
YNLEYERKKKEEGKRARADKQQVLDMLFSAFEKHQYYNIKDLVDITKQPVSYLKEILRDI
GIYNVKGTHKNTWELKPEYRHYQGEEKTDE
Download sequence
Identical sequences XP_018539266.1.34915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]