SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018553463.1.34915 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018553463.1.34915
Domain Number 1 Region: 29-517
Classification Level Classification E-value
Superfamily Sema domain 3.4e-98
Family Sema domain 0.00072
Further Details:      
 
Domain Number 2 Region: 1392-1515,1681-1865
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.47e-33
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 862-953
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000108
Family Other IPT/TIG domains 0.023
Further Details:      
 
Domain Number 4 Region: 1045-1129
Classification Level Classification E-value
Superfamily E set domains 0.000000000000433
Family E-set domains of sugar-utilizing enzymes 0.033
Further Details:      
 
Domain Number 5 Region: 953-1045
Classification Level Classification E-value
Superfamily E set domains 0.00000000000815
Family Other IPT/TIG domains 0.037
Further Details:      
 
Domain Number 6 Region: 515-561
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000401
Family Plexin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018553463.1.34915
Sequence length 1905
Comment PREDICTED: LOW QUALITY PROTEIN: plexin-D1 [Lates calcarifer]; AA=GCF_001640805.1; RF=representative genome; TAX=8187; STAX=8187; NAME=Lates calcarifer; AL=Scaffold; RT=Major
Sequence
MPPSIEIAVLLLGVLTLETRRSASALHIQQAFASPNQTNNFVVDPVSRKVYLATVNTVYQ
LNGTLILEVEKRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNYNKLLKLDREQGVVVVCGS
VYQGFCELRKMENISEIAVEFPPQGEKTVFPSMLNIAANHPNASTVGLILKSHGGNTRLL
VGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNIKDLSHLFTYDINPSEDNVFKIKQ
EVKTKNKLNFVHAFIQKSYSYIAFNNDAKTGHKESQPNSILARICLDTENPRKSSGSESK
KLTESYIQMPLQCGFNGNIYNRLLSVYPAEIHTDEGQGATEPYLFGVFSKEKPTDRKSAL
CAFKFGDIEEEIRQGRWNCSNSPSSDVQVLDSVIQGSGAACILKGNLVLQSEQLDCGAAH
LQHPLALRRSLRAIPLIEYPGLSSVSVDNVHNHTVVFLGTSNGRLRKLTLLPNMTLGNQW
KLKLPASEAVHHIMTFDPNDRNFLYLMTSHHMLRVRVAECDQWKSCSDCLGAGDAHCGWC
TLENRCTIQKECAQGLLARSWISMGEGPQQCPSMTLTPPEISISADIKDVGILINGSVPD
LVGSRVECEYGPGVSTAVTVHLDYGPAQIQTCPLLPRENYQPIPPGTDHLTVSVAIKVNG
TSVVSGSFIIYDCERTGAIHPKTSCVSCLSTRWKCYWDQENHLCVSSKDESKPNLLENAA
SCPSLVASEVPPSPSEMAQDFTLSLSNIQEGEELECDFGTEQRYEAIWLNSSTVKCSGVT
LSTNQWSQVYHLNLRRRGFFSGRREDIFVDSPQPMKVEVYNCGVGSSDCSQCWGREDQGH
LCGWCENSCKPRDDCQPIRAQCPAPEIHKIFPLRGPVEGGTLLTIEGRNLGRRAGAVKVS
IGDVPCVLLPELYTVSVELVCVTGRSEYDRTDIVQVNVDQSGMGTSKESFSYLVPKLLSM
EPRKGSRAGGTRVTIMGEHLDIGSEVRVKVNNTEKCTITEKTDETIECTMPPALQVNTES
VTVCVEFENLPCQSAELSTTYTYEKNPIISFIHPKKSYLSGGRTITVTGQGFDLVQSVTM
QVLGIGETPCTVFSSSMITCLSPESTQSQQTSVQFFLNGVLYIGDSPFSSDYDEPEEEEE
ETHKGQFLLEYVEDPQFFTANKEKLIKHHPGEPLTLIINKGPSDLELVPEEYSVMIGSYP
CNISFHNDQLFHCTINGLLSSSERELPVTVQVGNFRHTIAKVQLGGSELAIVVSIVVCCV
LLLLCTVALVVYCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELN
RSQGIPFLEYKQFVTRTFFPKMCSDYEKSLVQPVYENDALGPRALPETHPLLQDWQVRGX
ASRPNIEEGITLFSTLLNNKHFLITFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYT
SIMKDLLVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCA
IKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPQNINVSFQGCGMDSLSVRVMNTDTI
CQVKEKIIEAFYKNLPFSQWPRAEDVDLEWFDSGSNSKLLQDLDNSSLMEDGRKKLNTVF
HYQIPEGASLAMSMKDKKENTLGRVKDLDTEKYVHLVLPHDELMETKRSHRQSHRKKVLP
EIYLTRLLSTKGTLQKFLDDLFQAILSIPPDRPPLAVKYFFDFLEEQADKRGITDPDTLH
IWKTNSLPLRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTN
KLLYAKEIPEYKKRVQCYYQQIQEMAPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKY
AKRYRNQVVNALESNPTARRTQLHHKFEQVIALVEDNIYECCSEA
Download sequence
Identical sequences XP_018553463.1.34915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]