SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018590456.1.37976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018590456.1.37976
Domain Number 1 Region: 79-117
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000288
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018590456.1.37976
Sequence length 132
Comment PREDICTED: RIIa domain-containing protein 1 [Scleropages formosus]; AA=GCF_001624265.1; RF=representative genome; TAX=113540; STAX=113540; NAME=Scleropages formosus; breed=golden arowana; AL=Scaffold; RT=Major
Sequence
MRRSKTHLQRAIRRTERKATGSDGYHSNGRRGQPVRCSARAGKMAESSGLEKLDSGALSP
EQQEKLRQFKIKTRIANEKYLSAHPELELLLSEFLRDIFFKRPVDIREFAADYFTDANLP
KKILAKVEDNNS
Download sequence
Identical sequences A0A1W4YQ89
XP_018590456.1.37976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]