SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018594664.1.37976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018594664.1.37976
Domain Number 1 Region: 448-583
Classification Level Classification E-value
Superfamily TIMP-like 7.06e-24
Family Netrin-like domain (NTR/C345C module) 0.047
Further Details:      
 
Domain Number 2 Region: 222-317
Classification Level Classification E-value
Superfamily Immunoglobulin 6.63e-21
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 401-454
Classification Level Classification E-value
Superfamily BPTI-like 1.84e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0035
Further Details:      
 
Domain Number 4 Region: 337-395
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000104
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.019
Further Details:      
 
Domain Number 5 Region: 139-189
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000018
Family Ovomucoid domain III-like 0.038
Further Details:      
 
Domain Number 6 Region: 67-96
Classification Level Classification E-value
Superfamily Elafin-like 0.0000301
Family Elafin-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018594664.1.37976
Sequence length 589
Comment PREDICTED: WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 [Scleropages formosus]; AA=GCF_001624265.1; RF=representative genome; TAX=113540; STAX=113540; NAME=Scleropages formosus; breed=golden arowana; AL=Scaffold; RT=Major
Sequence
MAAGQESVGGLKGQRAFKRKADKGLHKALSHAIEHFTLYAFPPDRGMSERCVNEPPKLNA
NLWVDAQSTCERECLTDQDCAGFEKCCTNVCGLRSCVAARFPDSPGSQGEGQGGGQIAGR
RSSLASCHGFVCSQQGATCDVWEGQPVCKCQDRCEKEPSFTCASDGLTYFNRCYMDAEAC
IRGVTLTVVTCRYHLSWPYTSPLPLDTTAHPTPTSSQEDPLPPTLYSNPSHQSVYLGGTV
SFHCDVIGVPRPDITWEKQTDRRESLIMRPDQMYGNLVITNIGQLVIYNAQARDTGVYTC
TARNSAGILRADYPLSVIRRADDDLSDDFETSVPMGRPFSPADCLAEVDRRECGQRHVDW
YYDNKRGTCLAFTNGGCEGGRNRFETYEECRASCQREGMGICSLPAVQGPCKAWEARWAY
NSMMKQCQAFAYGGCQGNANSFRTRAECESNCPQPKSRPCRTCRVKGKIVPALCRSDFAI
VGRLTELIEDLDSGIARFALEEVLRDEKMGLAFFNTHHLEVTLAKMDWSCPCPNITMEEG
PFLVMGEVHDGMAVIQPDSYVRPITERRLKKIREVLEKKTCELLQRFQD
Download sequence
Identical sequences A0A1W4YSY6
XP_018594664.1.37976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]