SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018607216.1.37976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018607216.1.37976
Domain Number 1 Region: 262-359
Classification Level Classification E-value
Superfamily Immunoglobulin 1.26e-20
Family I set domains 0.018
Further Details:      
 
Domain Number 2 Region: 428-712
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.000000000000209
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.049
Further Details:      
 
Domain Number 3 Region: 11-63
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000319
Family Ovomucoid domain III-like 0.012
Further Details:      
 
Domain Number 4 Region: 187-275
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000134
Family I set domains 0.064
Further Details:      
 
Domain Number 5 Region: 78-174
Classification Level Classification E-value
Superfamily EF-hand 0.000000000903
Family Calmodulin-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018607216.1.37976
Sequence length 770
Comment PREDICTED: follistatin-related protein 5-like, partial [Scleropages formosus]; AA=GCF_001624265.1; RF=representative genome; TAX=113540; STAX=113540; NAME=Scleropages formosus; breed=golden arowana; AL=Scaffold; RT=Major
Sequence
PRGRRCLPDKETGRARCVCQDICRPTFVPVCGSDGRFYENHCEVYRTSCQQKRRIYVLHS
RDCFFKGDTCTMADYNKLKVLLLNMHPKNQSSEVLTQEKRMDQKRNLVDTMFMYLDADQD
GHVDSEELAQISMKDRLEDSLLECTMQDLLRYDDYNNDGLLTLQELYTAFQVVQLSLPED
KRVSISAVTVGLSTVLSCAIQGTLRPPIIWKRNGIVLNFLDLEDINDFGDDGSLYITKVT
TIHMGNYSCHAYGYEELFQIHVLQVNVPPVILVYPETQAQEPGMAASLHCYADGIPNPSI
IWLKNGMDLQPRLSKQLSLIANGSELHIGSVRYEDTGAYTCIAKNDVGVDEDISSLFVED
SARKTLANILWREEGLSVGNMFYIFSDEGVTILQPNECEVRKHVKRSDRIVASYEEVCPK
GEGDSPPKCTWASAVTVRDKYIYVTQPLQNRLLLVDTQAQKAVQVVETDPVPVKLHYDKS
HDQVWVLSWGDLGKTHPTLQVVSQASVGEEHRVFRTQFQRVDDFFIPPTNLIITHVRFGF
IFLKSETAVHKIDLETFHRVKTISLKNYSCVPAGMGYTHLSGYYFIHCQGRNSTLVPPQL
IIDSVTDSVIGPNRDIVGRPYVSPDGRHVATPDYRSGLLRVQTVTFQGKLQLSHEFDLGL
NISDLIFQPSFMESNQYSIVATSRSGTELLLANLSTGRREVLKTLKEPIPPESWSWNSAN
RLVVSSGLFGQFLVTPAAQSLFVLNGKQRSPHCELSDIKKGNTVVWIGEV
Download sequence
Identical sequences A0A1W5A389
XP_018607216.1.37976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]