SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018608482.1.37976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018608482.1.37976
Domain Number 1 Region: 59-472
Classification Level Classification E-value
Superfamily Sema domain 5.76e-99
Family Sema domain 0.00018
Further Details:      
 
Domain Number 2 Region: 1356-1483,1665-1851
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.85e-45
Family p120GAP domain-like 0.02
Further Details:      
 
Domain Number 3 Region: 831-927
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000112
Family Other IPT/TIG domains 0.0086
Further Details:      
 
Domain Number 4 Region: 924-1015
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000153
Family Other IPT/TIG domains 0.017
Further Details:      
 
Domain Number 5 Region: 474-527
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000366
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 6 Region: 1014-1058,1085-1137
Classification Level Classification E-value
Superfamily E set domains 0.000000957
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018608482.1.37976
Sequence length 1884
Comment PREDICTED: plexin-B3-like [Scleropages formosus]; AA=GCF_001624265.1; RF=representative genome; TAX=113540; STAX=113540; NAME=Scleropages formosus; breed=golden arowana; AL=Scaffold; RT=Major
Sequence
MPAAAPLLLIVAIWWWHLVLLLLLPPLTFALPQAPRLAAGSVSAEAPPRTSVLFEPVRIS
LNGSPLSHLLLDSASGHIYVGAVNALYHLSPDLELISSGRTGPKLDSPDCLPPIDPQDCT
QARETDNTNKILLLEEGGEKRCLIVCGTVLQGTCEKRSLGNVSEVLYQTDNPVDTQYVAA
NDPRVSTVGVVVEQKGTRLMLVGRGYTSKGPGGIPPITTRRLAPSRHHQAPTFSHEDLGK
LVVGSYSEFNNHFVAALRHNSHVYFLFSRRDVWRNREYRTYVSRLCAGDTSFYSYVEVPL
SCQGGYNLAQAATLGTHXXXXEVDRAMRQAQLLCYTKEGRDDQGKEEAYIEYEVSSQCLR
LAEDSLSKYPCGGEHTPSPIASAVPLQATPSLTSSSQLTAVVTSVEAGNTIVLLGDKKGQ
LHKVFLQGSGPGTVYESVQVDKDSPVNADLLLDTARQSVYVLTESKVTKVPVSQCEQHSD
CSSCLSAGDPYCGWCVLEGRCTRRMECPRHTQPNHWQWSYRSGSRCVTVERVEPDVLSRE
EQANVSLTVAQLPSLSEEESLSCSFGNIHIQAAVVMETSIKCQSPLPELLPPTPLGSDHL
SLRVSLMFGEVTISHTNITFYDCRAAGQLNTTSPCMACVGSVWPCHWCALDQLCSHAKRC
SHKHIIYNTLAQELEPRGADACPCVWALKGSPLVPVGLDMQLVLLGRNLDLFEDEEPYTC
VVDVEGKAVTLAASLEKGKGMQTHTITCAVHRFQYSTQQLEYSAPVYLRRGSSQRIDSTP
HLHLQLYDCAVGQSDCSQCRAVSARYGCVWCGGESPSCTYSGSCLSHPVETCPPPLITKI
QPQTGPLEGGILVTIWGSNLGQQFEDIQKGVTVAGVRCVPQPEDYVTSTRVVCELQPSQQ
ETRGPVTVSVGETEPGRSQQMFAYQDPQLSGIIPEKGPVSGGTSLTVQGSQLLTGQKVDL
AAYVGLHPCYVAEEVNDTQLVCRTSPVNRTAELQVRVLFGKAERIVGDVLFRYLADPVIT
DAKPVESFYGGGRAIKVSGRNLDVVQTPMISVSAEPAEDMVARKRRFSQLTQRNPHVINS
SIPKIQEPCIDVFPDQMTCVTPAVPSEFKVTGVWFELDNVRVDFASIDGKPFRYYPDPIL
HRLNRDVPDQPFHFKPGGVIAVEGEGLTLAMTREEVIAWVGVERCDIKTLDSTHLYCEPP
EIQPLSPDNSDTPPSLRVVMGKLEFDLGLVHYDNDVFSAVPLAAQVGLAAGAAVVVLVVL
VIILMYRRKSKQALRDYKKVLVQLETLEINVGDQCRKEFTDLMTEMMDLSNDVGGPGIPF
LDYRTYAERVFFPGQRGAPLSQNLDLPESRRQTVEQGLGQLNNLLNNRLFLIRFIHTLEA
QQSFSQRDRGHVASLLTMALHDKLEYFTDVMKTLLGDLVQQYVAKNPKLMLRRTETVVEK
MLTNWMSICLYSYLKEVAGEPLYMLYRAIKYQVDKGPVDSVTGKAKRTLNDSHLLREDID
YCSMTLTVLVNNGAEAQPVKVLDIDTITQVKDKILDQTYKGVPFSQRPSADSLDLEWRSG
QAGHLTLSDDDVTAIVQGRWKRLNTLQHYKVPDGATVALIPRSQGSGQLGVNQVYQTGEK
TPMLEVEEEEGLRLWHLVKSSEDPEIPKHRKSSMRERERAKAIPEIYLTRLLSMKGTLQK
FVDDVFVAILSTKRPPPIAVRYFFDFLDDMAEKHGIEDPETVHIWKTNSLPLRFWVNILK
NPQFVFDVQVTDSVDAVLSVIAQTFIDSCTTSEHKVGRDSPVNKLLYAREIPRYKQLVER
YYSDIHNAASGCYQEMNSTLTELSGSFASEMNGLVALHELYKYINKYYDQIIMALEEDAT
GQKMQLAYRLQQVAALVENKVTDL
Download sequence
Identical sequences A0A1W4ZXW7
XP_018608482.1.37976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]