SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018608776.1.37976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018608776.1.37976
Domain Number 1 Region: 239-413
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.89e-22
Family Clostridium neurotoxins, the second last domain 0.036
Further Details:      
 
Domain Number 2 Region: 600-741,771-791
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000000000247
Family Reprolysin-like 0.049
Further Details:      
 
Domain Number 3 Region: 1467-1541
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000556
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 4 Region: 1414-1472
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000417
Family Complement control module/SCR domain 0.004
Further Details:      
 
Domain Number 5 Region: 1533-1590
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000292
Family Complement control module/SCR domain 0.0045
Further Details:      
 
Domain Number 6 Region: 509-619,693-729
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000403
Family Reprolysin-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018608776.1.37976
Sequence length 1736
Comment PREDICTED: pappalysin-2 [Scleropages formosus]; AA=GCF_001624265.1; RF=representative genome; TAX=113540; STAX=113540; NAME=Scleropages formosus; breed=golden arowana; AL=Scaffold; RT=Major
Sequence
MNTWLLNSAQSNHVQRYKRALARKADRLQASLANEQCRSASRARQRPLGAVHRSHPKLRD
FQRDGAASEEETCPGGCSSHTGHGTAARILQSGAHGPWRIDGRGASEETPGATRVPASDR
SFSGVKSRRGWESDAIAAETGRQPKEAGEPPVPRERLHRGVPIQKRTPRSPARPSEKEKR
EGFPDDAAASRKRYGSFHPTGYSNESDDYSGEHEGLSRSARESWGFTEQDLPPQWMTTIY
FRGQKEQLRVHPALGLVLPRAAFSVELWVKPEGGQSDPAIIAGVFDNCSHSLSEKGWSVG
IQTVDPMKKRDARYSFTLRTDRAPKATTITGHQRYEPNSWTHLLASYNGDKMSLYVDGAK
VGESSGQSGNLHSAFMSACRVLLLGGDQTDLGHSFRGQISGFVLWGGPRVQDEFSKGNPQ
EAPEEPLLAFRGDFSALLQHWVPYKDGSPPTLDFTPIPDQKVVSPFLPPPCGVTTCDNKD
IVLSYNDHWQLRTRKHIRYRVVNICNDDGSHPTVSQDQIQRQHHALTEAFQPYNITWELT
VQTIHNSSLRQRFVLSNCQISKIGNRHCDLECDHPLTGHDGGDCVHLGPCYNWKRRDGVC
NMECNSIRYDFDDGDCCDPEVTDVKKTCFDPESLDRAYMSVKELKDVLQLSSNDTLNVFF
ANNSVREELAGAATWPWAKEALGHQGGMVLNPSYFGTAGHSNTMIHEMGHILGLYHVFKG
VSERESCDDPCRETVPSMETGDFCEDTAPTPKFKACKDPEPIIDTCGPSLYEKTPYNNYM
SYTDDNCTNNFTPNQVARMHCYLDLVYQKWVHSKKPSPVPLPPILIAQSSNSVTIHWLPP
VSGVLHQGEGDVNCRSCNKEGALLQYAHKATSPRACDSSGYWTPEEAVGPPDVYQPCEPS
LQAWSPELHLYDANVTSPCPKTEGCVLVLHFLHPVIPETFTVWVTYIATDSQAIANIEFL
TDSGESLHMGPRDVFCDMPLTMRLHIHKKVTGVKIYTFDEKMEIDAVLLTSISQNPLCAT
CQPLYYHLIREPPLERGPVRQTQLTFSDSDLAIGAQYEYRVRVEAGGILSELSPPLLYSL
GSSFCGDGQLQGEEQCDDENLLDGDGCSKKCLMEPGFNCDGEPSQCYVFDGDGVCEEFER
AYSVRDCGFFTPEGYRDQWASEAWASHQDEARCPAVAVTGEPSLQQLCKSQYLDMNERLS
RYAWFPCTAQPHSYNHPDQEQAIWLKVGFARPGVAASVIIYLASDGTWPGEQCRKTVAIQ
LSDTSGKNHSIGDFELSCHHNPLVVNVTHNLSLPFFLTTAVLLNFSSPLVAVTGVALRTS
CRFSAFALTGCVHQPCSSEPCNPLQLDQASVTCRPGTEALRCTVLCHQGHTLRAHSGGRL
PPNQKETEVECMRGVWDRVVSCQPVDCGLPDQSHVYFASFSCPEGTTFGKRCSFSCNPPS
MLQGISEWLECLEDGLWSSPEAYCKIECSEPPKVPNAKLLVPQCEGRQHNVGTLCRYKCK
PGYYVTGSPNTKPRMRFLKLECLAEGQWEHGNCEPISCPSPPSVFEGMYSCTKGLEFGSI
CKLTCPDPSESYTVRCTKDGMWTEELIMCSSVQGSCAPPPDLNLVEYTCEDGYSVGAVCY
PTCIVALSDPVVLPGDVTADTLKHWMLPTEVQGIVCTGRKTWHPHPKLVHCIQSCEPFGG
DGWCDTINNRAYCQYDGGDCCSSTLSTKKVIQFGAECDQDECSCRDPTAEENQQQG
Download sequence
Identical sequences A0A1W5A7Q3
XP_018608776.1.37976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]