SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018636198.1.89292 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018636198.1.89292
Domain Number 1 Region: 292-402
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.18e-19
Family Nucleotide and nucleoside kinases 0.0016
Further Details:      
 
Domain Number 2 Region: 91-215
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000341
Family Nucleotide and nucleoside kinases 0.0013
Further Details:      
 
Domain Number 3 Region: 49-89
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000178
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018636198.1.89292
Sequence length 412
Comment adenylate kinase [Toxoplasma gondii ME49]; AA=GCF_000006565.2; RF=representative genome; TAX=508771; STAX=5811; NAME=Toxoplasma gondii ME49; strain=ME49; AL=Chromosome; RT=Major
Sequence
MDVLVAENGAQGKHALVPLVASSVAAPPSVPSNVVTDPQFAAERKAFMEETTEFVEKYHI
NELFNDLLKELILNYPDNPIEHLIDYLERPPSLRVVIIGPQACVGSQRSELCDKLADTHG
LIHVHAGRLIRAYLKKSDSGLLSHCIQKGELVPDSIAIDAVLPIIRKNGRRGCVINGFPR
TRVQAVALQESRIVPDKFIILTVPGRDLQVYFQLLPTTEEHETNAARNSLVDETCHNTPQ
ASRMLGYEQAEKQCSTKARAYERHISGVMQQYASAYHTISTSATLDETLQKIRVLGPVGS
GKSTQAKLLADWYGVVHVDAQQLVRELALKDEKLRTVLHESEEKGTLLPQEFVLPPILNR
LRQADCSSRGWVLEGFPQTCSQAEWLRNMRLTPTQVIALDIDAVSQAITGDA
Download sequence
Identical sequences A0A125YLZ1 A0A139Y1B7 A0A151H545 S8EVN3
XP_018636198.1.89292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]