SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018643447.1.24268 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018643447.1.24268
Domain Number 1 Region: 493-809
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.57e-48
Family Duffy binding domain 0.0000159
Further Details:      
 
Domain Number 2 Region: 201-478
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.84e-45
Family Duffy binding domain 0.00000576
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018643447.1.24268
Sequence length 1427
Comment erythrocyte binding antigen-165 [Plasmodium gaboni]; AA=GCF_001602025.1; RF=representative genome; TAX=647221; STAX=647221; NAME=Plasmodium gaboni; strain=SY75; AL=Chromosome; RT=Major
Sequence
MRKTLKLFCISGFLFSCRTLCKLDNYLKNEYEKENSFNIINNKVEKEYDSGTNNNVNIDR
SSNGRLELLEVKEEALLNDKNIEEEEAENNINFEEKILYKNVYELNKENLEKEGLYKRNT
IKNIENDSLYKKGKLNFLYEYGMELLNINKVPMNKMTNSRGLGDSNMSFLDISNNNNKNK
NNNMNNLNSLSFVDMKSIHRCITKRKKGEKDWACNDKNTKEPNICVSDRRVQLCTGNLVD
LSINDATKEKFEEKLIIAAKREGTLLFEKFGKEYTAEFCLNLKWSYSDYGDIIKGTDMEG
VGRSIKVEFEIDRIFKSDQANSKENRKKWWDEISVKIWNAMIEEHKEKLPENIKECSKEK
PSDEPQINRWLMEWAYDTDYHKDKWYNKLDDPKSNCNSICPKERVCKSECTKYKTWVNKK
NSDFTILSAIYLKYNKTNLSYKTAFEYLQHKWYKYNELNFGSIFDQLNAKYYNKCVCQNS
MLGNNALFIKIENVCTNQEVKSIYGQLYCREKGNDKIWQCVNDNIKDFPDVCGPPRRQQL
CLGNLDKDEFKNVSDLRVFLNEIILGIKDEGKYLIEKYRKNMHENKYLNKMACKYLNYSF
DDYKNIILGKDMWRDTNSIKTENILKENFEAIKANIVRQYPSYADLSLDEFRKHWWDQNK
SQLWEAISCEFYNNNHTEVCLMEDDDDNQYLHWFREWKHDFCIEKTKRNNVIKEQCIDKV
IKTPEQMDNAHDVDAVCKKSCTDYDVWIINKLNEYKRQASKYKRDSSLYNDVIKNLKPWE
YLSMKCTECTCDLDTETFVYPYKGYENICKINGDPYDPKSIEGEEFNKPSLNVKSERSAP
SKDITEREAPGVDVLSIKETVHLEPFKPNAVDHISDPFIGRNSKEGGSSPRGANDILHTS
TEKHTYNDGVSASSSSLDSSSRSDVSSSDVEGFGVGQQEHGSDELLSSQTVTGGITESEG
TTLSQHENEPRQTHANLDGESVSMDSTKDTKHSSITSDVTHETNSLSVGENKDQETTLRE
GESVTTSPLEDETSTMNTHSDRTNIGQVSGVPVDSLSETQKEYRSGLETEQMKGEEVNAI
NPNNDMALKDDSVERREDENAHAKEHSGDSAPSKEHMNASQGTEHKLENSERPEKSKRAD
SRLESKSNKLSSTSHVNHNDSIERTSERSIDGSHNGYGHDRSDNPRHRMHINNRSRHGQL
ESDIVVRGDYINNNEEVKEDVESTLNDHRNNLNNMHNRTYNIEEYIYRDVNKVAHDIMKS
YKSNGCTNDLSSAYCSNLKKESLSNVCTNEDSRNLCCSISDYCMKFFNFNSSGYYSCMKK
EFANPEYKCFARKGFSNMYYFAGGGLFFIILFLLGTTSSIGKWSEENELNGTAFEEANFE
DAAFEVTTGQDSAFEEYGDNAYRIGLLMNQKIQSAKSSDYSEYHMDN
Download sequence
Identical sequences A0A151LUR6
XP_018643447.1.24268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]