SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018643865.1.24268 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018643865.1.24268
Domain Number 1 Region: 410-722
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.37e-51
Family Duffy binding domain 0.0000238
Further Details:      
 
Domain Number 2 Region: 124-396
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.23e-46
Family Duffy binding domain 0.0000327
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_018643865.1.24268
Sequence length 1521
Comment erythrocyte binding antigen-181 [Plasmodium gaboni]; AA=GCF_001602025.1; RF=representative genome; TAX=647221; STAX=647221; NAME=Plasmodium gaboni; strain=SY75; AL=Chromosome; RT=Major
Sequence
MKGKMKMCLFFFYSVLYFVLCTYVLGISKELLKERTQSLNDNNNDSYNNNNINDQLSFAN
EVVRFIENEKDDKEDKTMKIITRPVDNTLNRNTDNSFLNIKKYGRKAEYLNRSSFVQRAY
ISDCQVKRKAHTWICENEGNNNICIPDRRVQLCIAALKDIKNSGSERMDRELLTDKVFES
AMYETDLLWKKYGFRGYNDFCDDVRNSFLDYKDVLFGKDLDKNNISKLVEKNLKSFFKED
STILSPDVWWGIYGAKLWRSMIKPYIDFGCKIPDDSEPQINRWLREWGKYNCKLLKEKQK
SLEKQCSVNKRKTDCSSKCNSECYSYRNLIKRQKYEINILAKRYVQVIRYNIFNKKIVQP
NNAYDFIKANCTDCKDIDFKTLFEFEYGKYEEKCMCQSFLDLRIQFKDYEVCSFNADKHT
VSSDKRFCLAKKEFKPWQCDKNTFEKVHNEGVCVSPRRQGFCLGNLSYLLSDDIYKIHNK
QLLIEIIMASQQEGKLLWKKHGIILDNDNACKYINDSYNDYRDVVLGNDLWNDKNSVKVQ
QNLNMIFERNFGYKVGEHRLFKSIKELKYVWWILNRDKIWDSMKCGIQEVDPRRISCKKM
DELENMPQFYRWFSQWAHYFCKEKEYWESKLNNNCKDPKGKSLCNETTCQNVCTRMNYWT
YTRKIAYQIQSAKYDKDKTSFNLAKDKDVSTFLKENTNNCSNIDFTKIFDELDKLFKERC
PCMDTKTLETKNKEMLSLEKISDEETDINEESEEEEESQEYELLARRTNGNKGTKSDPNE
IEKNKDEQQPEKEEATQTSGSLEVQENKDSDSINGGGATTDKANPSEELEEVPKDASNTE
EIKEQPALTESPENSPKQAQAQGESEQKSNESERSESDQPPTGGEASELKNETSLEQERK
ESSSSAEEDSSKTPSENTSSQDTEAPSENTSSQDTEESSIGQTDEHVVDKEPVSTNLEHG
VVDKEQMSDPNKSTGKNVSLEGDKDEAVESTVSITDSNEQKGQSTQSTHIPVVVGEKEEN
SISPVTENSESASGLNSTNGIETTTIDVKEQQTIKSDESVSETSESSSEISSVVDASHEK
TETVPPGTSIEEEKEILKSKQIDTTSEPDLGSNDQKDVTDNSAEVNRNDDNNLPNSIDNP
SDDINREVITASETQDVSEPKGSNKETSIEVPSITVTTSDDRSSVEEERKTKEEPVTQRE
ILESIQNSVNEHTPDNEQKDEREALRSEEYKLYSGTPSEDISERDLNDIKSLKANMDNIS
LGDSSENRESAEGTESRHRELRQHDFRGEGNFENDVGQVQDSVIENEEFKKLLNKEYEEN
DNEEMMNGTTYSMKDRVNNLSSEEKMNEYKNRNVTEAREEILRMSKTNTCSNNHSLKYCD
YMERNKDLLETCSLENRLHLCCAISDYCLKFFNPNSLEYFNCTQNEFDDPTYNCFRKERF
TSMHYIAGGGIIALLLFILGSASYKKNLNDEDGFYDSNLNDSAFEYNNNKYNKLPYMFDQ
QINVGNSDLYSEGIYDDTTTF
Download sequence
Identical sequences A0A151LWV5
XP_018643865.1.24268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]