SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018648619.1.29077 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018648619.1.29077
Domain Number 1 Region: 135-315
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.7e-22
Family UAS domain 0.019
Further Details:      
 
Domain Number 2 Region: 363-458
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000269
Family UBX domain 0.021
Further Details:      
 
Weak hits

Sequence:  XP_018648619.1.29077
Domain Number - Region: 19-55
Classification Level Classification E-value
Superfamily UBA-like 0.0289
Family TS-N domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_018648619.1.29077
Sequence length 513
Comment fas-associated factor-related [Schistosoma mansoni]; AA=GCF_000237925.1; RF=representative genome; TAX=6183; STAX=6183; NAME=Schistosoma mansoni; strain=Puerto Rico; AL=Chromosome; RT=Major
Sequence
MLDNDNVDEAHALSESEAQDVQHLREIAGGIGYLDALKLLEESSWDLERAVHKLMGFEDS
SLRQRSTASRASSVPQVELVPPNQRILRSRNSTHSWLWSTALFLLEPIRMGCSFFFGIVK
FFASFLWSDPRNQVTDPAGDVRKFIQHFKETYGPVNTSFDVDGNSNPTENSTSDSFPPFF
EGTYADAVQEAKQSLRFLIVYLHGDSHEDTHRFCKDILQSEDVLRFLRNSNELLFWGCNI
ESPEGYRVSRTLREHTYPFIGVIGLTNMPISESGIYTGSSTRMALLGRIEGVLESSELVN
QLNSILNEHQTAIITARLDRSEREMNAQLRREQDLAYEASLAEDRAKMAAREAQQRSAAL
EAEQLAKDAKRKEDLQKAHINRKRIWKNRLPPPPKFEEGSTVQLSFKMPHGSRVSRVFNL
NDSIKLLYYFILSQDDSPTEFEVQSNFPKRIIPCQPFEESDVEDYVNTPDNKMDCDEPEV
ITDWSPKCQNDPPSFFDIDLTRPEMLFVLNKDA
Download sequence
Identical sequences G4V6D7
XP_018648619.1.29077 Smp_084610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]