SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_018783073.1.52592 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_018783073.1.52592
Domain Number 1 Region: 992-1212
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.63e-56
Family DBL homology domain (DH-domain) 0.0002
Further Details:      
 
Domain Number 2 Region: 74-192
Classification Level Classification E-value
Superfamily BRCT domain 3.63e-18
Family DNA-repair protein XRCC1 0.043
Further Details:      
 
Domain Number 3 Region: 210-261
Classification Level Classification E-value
Superfamily BRCT domain 0.000000349
Family DNA-repair protein XRCC1 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_018783073.1.52592
Sequence length 1473
Comment PREDICTED: protein ECT2 isoform X1 [Bactrocera latifrons]; AA=GCF_001853355.1; RF=representative genome; TAX=174628; STAX=174628; NAME=Bactrocera latifrons; AL=Scaffold; RT=Major
Sequence
MDAMETIDEQSKSEMSISPSPSPENLRICLVGDVVNDTETVEAARCFNVPVITSENGLDV
LNDYAWRTFFVLKDFEGPIYDAIHRNKQCILGPPALQHAAESKDGLIRNARPVYNYSMRG
VVTCFTGIRKKDELTRLVNLIHSMGGCIRKDMNSKITHLICSHSGGDKYQYAKTFRLTVV
RPAWVYAAWERRDELQFRATTDDFSREHKLKAFEGQKICFFGFPADEHQHMVDVLLSNGG
VPAELDDPECSHVVMPNTGGYFLETMTNTCNSPKPQPIITNPQSHPQPTTPKRLYKTETV
EITSTKKSMEENSEAAPLVATTSSSVDIDKTEGNTVNEKEPEKAAPTANADTQMDVDVAS
TTEQLVDSPETEDGDGADNNMDNENDDVDDDDDDGDYFDERLVVDYDRNKALQHGSPLPE
GVDIDDPEDMMPVGQQNASTPQKPTASAALSTPSKYDINANSSGAELETENVKCLNENAS
TPIKTTNVAAADNADPNKSITDGIIITKEAFHNPNNISPILNAMPEATVTAAKPTNILQI
PNLIVTANSSPESEPSPMEIEAEAYDMNADIEAEDFGNLNELKRKRESFDSISLMSVESF
ALPNSTKKPKLLRTGSITRSIRRSMSFVAVRTPISKMLRPRRSSVALDGAPNDEDGCNAD
DSFCSIASIESTFNESIRKPVKEKFRSLRNRITRSSSKKDKHSMHAQPTTPEKDEKYERE
MPNSGFKTPKAPAKFLSAAAKAIGTPKSFTKHALISAPSPSTSTLTSNKLASAGLECSKW
PITAEVTPSTINTPTTATYITPATISTISLPHSPPPMQNPKLIANQEIMQENTQLHAPAQ
AQTLENVQCIREHMQSAAVERSLMVVDEHTTQAKPEPKNHRTHILKSDWFWYTIQNGYAD
EMDYLFGDYLDSIANTPNTDRRDSLPISFNKRKRKRFSQRIQFEGTPIGSGKRRSSVSDA
GLLSVSGSFFDCTTSPDKLEAGKLHNEVHIETPTVCESTPAKKSMRFNHFMDFFSTESNY
VGILDTIVKLFKNPLEEIAETNDALLNKSEIKSIFNNFLPIHEVHQCMLESLRAIQGKWS
EDCLIGDIILQHRDELTKAYPPYVNFFEQMKETLQQCDSQNPRFHAFLKINQTKPECGRQ
SLQDLMIRPVQRLPSISLLLNDILKHTNKNNPDYVKLEQALKAIKEVMMHINEDKRKTES
RMAIFDIFNDIEGCPAHLVSSNRSFISKCEVTELSDNLSGRGDTLMLYLFSDTIEVCKKR
SRAFNTAKSPSSTKSYKHVKLVSLNAIRFVIDITDSPRAFALLCRQDKEKLFSFTITDDE
TDKVVYLKLLCKQMAENACRTDTVSALLSRTSQELEVDISDVNLSTLSKAFKLAARTRQK
VGRAFSFNKTPSKLKRAVSTMMTPPFGSTNSLTPASQLAQMRLASCANIHEAVDEEGNRS
SSPSVQSEILLPPLSVQPMRKNKSSTLGVVGRL
Download sequence
Identical sequences XP_018783073.1.52592 XP_018783082.1.52592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]